Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05836
Gene name
Locationscaffold_06:2378377..2379152
Strand+
Gene length (bp)775
Transcript length (bp)714
Coding sequence length (bp)714
Protein length (aa) 238

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09177 Syntaxin-6_N Syntaxin 6, N-terminal 1.1E-26 10 108
PF05739 SNARE SNARE domain 2.8E-06 181 233

GO

GO Term Description Terminal node
GO:0048193 Golgi vesicle transport Yes
GO:0016020 membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0016192 vesicle-mediated transport No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

Domain # Start End Length
1 214 236 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05836
MMSSTTEEADPFVQVQQDVLAQLSSTRPLFASYLRIRSLSSTASSPELASARKDLESALRTLAEDLSDLEASVAA
VESKPSQYGLSSDEVARRKRVVREASGELQDMRQELSRNAALASSSAVADSSPADDDEDFAAGFEQEQQVQMMRD
QDQHLDGVFQTVGNIRRQADDMGRELEEQHEMLELVDQAADRVGSRLQNGMQKLQHVIRNNEDRWSSCCISVLIF
VLILLLFLLLII*
Coding >Ophcf2|05836
ATGATGTCCTCGACCACCGAGGAGGCCGATCCCTTTGTCCAGGTTCAACAGGATGTCCTCGCGCAACTATCGTCA
ACAAGGCCCCTCTTCGCCTCATACCTCCGCATTCGCTCCCTCTCATCCACGGCGTCCTCTCCCGAACTCGCTTCA
GCACGGAAAGATCTCGAGAGTGCTTTGAGGACGCTAGCCGAGGATCTCTCTGACCTTGAAGCTTCCGTCGCGGCT
GTCGAGTCCAAGCCTTCGCAATATGGTCTCTCCTCCGACGAGGTTGCGCGCCGCAAGCGCGTCGTTCGGGAAGCC
AGCGGAGAGCTACAAGACATGCGCCAGGAGCTCTCTCGGAATGCCGCCCTCGCTTCCTCTTCTGCCGTTGCAGAC
TCCTCGCCTGCCGACGACGATGAAGACTTCGCGGCGGGCTTTGAACAGGAACAACAGGTGCAGATGATGCGCGAT
CAGGATCAGCATCTGGATGGTGTGTTTCAAACAGTCGGCAACATCCGTCGTCAGGCGGATGATATGGGCCGCGAG
CTGGAGGAGCAGCACGAGATGCTGGAGCTCGTCGATCAGGCTGCCGATCGCGTCGGCTCGAGGCTGCAGAATGGC
ATGCAGAAGCTGCAACACGTCATACGCAACAATGAGGATCGCTGGAGCAGCTGTTGCATTTCTGTCCTCATCTTC
GTCCTCATCTTGCTACTCTTCCTCCTCTTGATTATATAG
Transcript >Ophcf2|05836
ATGATGTCCTCGACCACCGAGGAGGCCGATCCCTTTGTCCAGGTTCAACAGGATGTCCTCGCGCAACTATCGTCA
ACAAGGCCCCTCTTCGCCTCATACCTCCGCATTCGCTCCCTCTCATCCACGGCGTCCTCTCCCGAACTCGCTTCA
GCACGGAAAGATCTCGAGAGTGCTTTGAGGACGCTAGCCGAGGATCTCTCTGACCTTGAAGCTTCCGTCGCGGCT
GTCGAGTCCAAGCCTTCGCAATATGGTCTCTCCTCCGACGAGGTTGCGCGCCGCAAGCGCGTCGTTCGGGAAGCC
AGCGGAGAGCTACAAGACATGCGCCAGGAGCTCTCTCGGAATGCCGCCCTCGCTTCCTCTTCTGCCGTTGCAGAC
TCCTCGCCTGCCGACGACGATGAAGACTTCGCGGCGGGCTTTGAACAGGAACAACAGGTGCAGATGATGCGCGAT
CAGGATCAGCATCTGGATGGTGTGTTTCAAACAGTCGGCAACATCCGTCGTCAGGCGGATGATATGGGCCGCGAG
CTGGAGGAGCAGCACGAGATGCTGGAGCTCGTCGATCAGGCTGCCGATCGCGTCGGCTCGAGGCTGCAGAATGGC
ATGCAGAAGCTGCAACACGTCATACGCAACAATGAGGATCGCTGGAGCAGCTGTTGCATTTCTGTCCTCATCTTC
GTCCTCATCTTGCTACTCTTCCTCCTCTTGATTATATAG
Gene >Ophcf2|05836
ATGATGTCCTCGACCACCGAGGAGGCCGATCCCTTTGTCCAGGTTCAACAGTACGCAGCGAATCTCTCACCTTGT
CTGATTACGTCGTCATCAGCTCACACACTCCCTCAGGGATGTCCTCGCGCAACTATCGTCAACAAGGCCCCTCTT
CGCCTCATACCTCCGCATTCGCTCCCTCTCATCCACGGCGTCCTCTCCCGAACTCGCTTCAGCACGGAAAGATCT
CGAGAGTGCTTTGAGGACGCTAGCCGAGGATCTCTCTGACCTTGAAGCTTCCGTCGCGGCTGTCGAGTCCAAGCC
TTCGCAATATGGTCTCTCCTCCGACGAGGTTGCGCGCCGCAAGCGCGTCGTTCGGGAAGCCAGCGGAGAGCTACA
AGACATGCGCCAGGAGCTCTCTCGGAATGCCGCCCTCGCTTCCTCTTCTGCCGTTGCAGACTCCTCGCCTGCCGA
CGACGATGAAGACTTCGCGGCGGGCTTTGAACAGGAACAACAGGTGCAGATGATGCGCGATCAGGATCAGCATCT
GGATGGTGTGTTTCAAACAGTCGGCAACATCCGTCGTCAGGCGGATGATATGGGCCGCGAGCTGGAGGAGCAGCA
CGAGATGCTGGAGCTCGTCGATCAGGCTGCCGATCGCGTCGGCTCGAGGCTGCAGAATGGCATGCAGAAGCTGCA
ACACGTCATACGCAACAATGAGGATCGCTGGAGCAGCTGTTGCATTTCTGTCCTCATCTTCGTCCTCATCTTGCT
ACTCTTCCTCCTCTTGATTATATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail