Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05830
Gene name
Locationscaffold_06:2361732..2367776
Strand+
Gene length (bp)6044
Transcript length (bp)4542
Coding sequence length (bp)4542
Protein length (aa) 1514

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12701 LSM14 Scd6-like Sm domain 6.5E-31 3 78
PF09532 FDF FDF domain 4.5E-20 399 498
PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain 8.1E-20 788 982
PF04675 DNA_ligase_A_N DNA ligase N terminus 2.2E-17 526 710

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0003910 DNA ligase (ATP) activity Yes
GO:0006281 DNA repair Yes
GO:0006310 DNA recombination Yes
GO:0003677 DNA binding Yes
GO:0051716 cellular response to stimulus No
GO:1901360 organic cyclic compound metabolic process No
GO:0140097 catalytic activity, acting on DNA No
GO:0016886 ligase activity, forming phosphoric ester bonds No
GO:0003824 catalytic activity No
GO:0043170 macromolecule metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0003909 DNA ligase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0006259 DNA metabolic process No
GO:0033554 cellular response to stress No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008152 metabolic process No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0036094 small molecule binding No
GO:0006950 response to stress No
GO:0000166 nucleotide binding No
GO:0050896 response to stimulus No
GO:0006974 cellular response to DNA damage stimulus No
GO:0090304 nucleic acid metabolic process No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No
GO:0016874 ligase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6078 0.6855 0.2473 0.0417 0.1146 0.0229 0.1069 0.0283 0.0559 0.0086

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4443
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4779
Ophiocordyceps australis map64 (Brazil) OphauB2|7756
Ophiocordyceps camponoti-floridani Ophcf2|05830 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1683
Ophiocordyceps kimflemingae Ophio5|3598
Ophiocordyceps subramaniannii Hirsu2|9211

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05830
MSEFLGSRISLISKSDIRYVGTLHEINSDESTVSLENVRSFGTEGRRGRAEDEIAPSDQVYDYIVFRGSDVKDLR
IEEHPTIKENKPPPAMPDDPAIVGARPREATSGQAAPPVTGHFPPPYPPNNFYGGPPPPGSWGRGGGGPMPGPGG
DFGMSYPPPPHWFPHGQGFPPGGPAPWSGHHPPPVSGAPPGPEGPTPRQPPPAGPLQDAKSGTVGPGPDRVTSAT
PSFKAALPTEPKPPVQVGRQTSKAPSPPIESKPSAEEVKAVATSLSGNGPLPNAADLPKPTIPTAPRNIKITPVI
PLSGPSAKPFSLSSSSGKVDQQVAVKAHVAAAPASVEDATNAARAAVAAAMAQLGGGGGNAMDNLTNKVNEMRVN
AGRGGTAGRARGRGGRHGTQKVEVPDSDFDFQQSNAKFNRHEIAKEAIAGSPISEKQVEITPNTEVEAVNGNPAV
AYNKSRSFFDNISSEAKDRADNGGQKPGGREWRGEEQRRNMETFGQGSVDGGYRNYRGRGRGRGNRGRIYYTMPV
PFSLVCQLLDECQRLCSAGKSNSRAVDEWFRRHRGCIDGHDSEPSALLSTLLPEKRTDRVYSIQVTSLERMVARA
LMLGSSRVAELARYKQPGAGLDLADCVERILIATPNPRCVGLDKVTVEELDSLLHGLASGVRWSSPSIRNSPKTT
GQSTRVDIERIYRRLEPTEAKWFTRLILKNFQPVILDSSLVVGCCHPLLPAMLKIRDDFSAAIRMLRHVQGESSS
NSASVASNDRTVLLSLKPQVGIKVGRQDWVKGRSIKHCFDLGHGRMSIERKIDGEYCQIHVDVSTATPTLQIFSK
SGKDSTEDRRAVRGAIYESLRIGRPGCGFRSKCILEGELVVYSHREKKILPFHRIRNHVTRRGVYLNTEQDERPD
GSEELMMIYFDMLLLDDRSLLHVRRCERFELLRKTVHPVVGRAEIVSRQLVDFGHPYAASDLRNAFAKVIVERGE
GLVLKPDEPYFNFFRRDLPFPGLCIKLKKEYIGNLGEIGDFAAVGAGFDASRAKIYNVPNLRWTHFYIGCLENKE
QVLRWKATPIFTVVAVVELNASQLQTVHTFGFPSPMPAADNETTRLKVPKGIETGPSLTVAFGNPLVFDMRCFSF
DRPGNVGFWTLRFPCVSKIHFDRDFLDTVTFDEMQALAESATTSPEAEDSQENLEWIAKLESADPKRPIDAVTQS
TQATEVTPSPDRSTQRTWNHGLEASKGGGEDDMDSQATASEDEAAFCDELPRVSFPRQRATLGCVQKRWAPLSDI
ASPTRKRPRSQESEAASRQPLLDRSTNVPSSREGILPEMTRSGTLREGDEEPIASEESSVEAWRAKWLDSLDAIM
GEGGVKEACRSNPTTRCSYADAKCQLAAFTVLVSSMALVDEEEPAELLRAHGVLDTVTLAERWLKTGKKTRSSVQ
GSKAAREPGRRKAKLMLLVDSIGKGAADVKALVARIGKMHNRSRGGGWIAVYDWRVLRNLSILEDEGQSRKYYDG
FSDPWRRWHCGYC*
Coding >Ophcf2|05830
ATGTCAGAGTTTCTTGGGTCACGCATATCCCTCATCTCCAAGAGTGATATTCGCTACGTTGGCACTCTACACGAG
ATCAACTCGGACGAGTCGACGGTGTCTCTCGAAAATGTGCGATCTTTTGGGACTGAGGGCCGCCGGGGCAGAGCC
GAGGACGAGATCGCTCCGTCTGACCAGGTCTACGACTACATCGTCTTCCGAGGCAGCGACGTAAAGGATCTGCGC
ATCGAGGAGCACCCGACTATCAAGGAGAACAAACCTCCACCTGCTATGCCCGATGACCCTGCTATTGTCGGCGCT
CGACCTCGTGAGGCCACATCGGGCCAGGCTGCTCCTCCGGTGACCGGTCACTTCCCGCCCCCATACCCTCCCAAC
AATTTCTATGGTGGACCGCCGCCTCCCGGCTCCTGGGGTCGTGGCGGCGGAGGTCCTATGCCAGGCCCCGGCGGC
GATTTTGGCATGTCGTATCCCCCGCCGCCTCACTGGTTCCCCCACGGTCAAGGGTTCCCGCCGGGCGGCCCGGCT
CCATGGAGTGGCCATCATCCACCGCCAGTCTCGGGAGCTCCCCCAGGTCCCGAAGGCCCGACCCCTCGCCAGCCG
CCACCGGCCGGACCCTTGCAGGACGCCAAGTCCGGTACAGTCGGGCCCGGCCCGGATCGTGTCACGTCGGCGACG
CCCTCGTTCAAGGCTGCTCTCCCGACCGAGCCCAAGCCTCCGGTTCAGGTTGGCCGCCAGACAAGCAAGGCTCCG
AGCCCACCGATAGAATCTAAGCCTTCGGCTGAAGAGGTCAAGGCTGTAGCTACGAGCCTGAGCGGTAACGGGCCT
CTTCCCAATGCTGCTGATCTGCCCAAGCCTACGATTCCTACGGCTCCACGAAACATCAAAATCACACCCGTGATC
CCTCTTTCAGGACCGAGTGCCAAGCCCTTTTCGCTTTCTTCCAGCAGCGGAAAGGTGGACCAACAAGTCGCCGTC
AAGGCCCACGTCGCCGCGGCCCCGGCCAGTGTGGAAGACGCCACGAATGCTGCCCGTGCCGCAGTAGCTGCCGCC
ATGGCTCAGCTCGGCGGCGGAGGTGGCAATGCCATGGACAACCTGACGAACAAGGTCAACGAGATGAGGGTCAAC
GCTGGCCGAGGAGGGACAGCTGGTCGCGCTCGCGGGCGCGGAGGACGGCATGGCACACAGAAGGTCGAGGTTCCG
GACTCGGACTTTGACTTTCAGCAGTCCAACGCAAAGTTCAACCGACACGAGATTGCCAAAGAAGCAATCGCGGGG
TCGCCCATATCGGAGAAGCAGGTGGAGATTACACCGAATACGGAGGTCGAAGCGGTCAACGGCAACCCGGCTGTC
GCGTACAACAAGTCCAGGTCTTTCTTCGATAACATCTCGAGTGAGGCCAAGGACAGGGCGGACAACGGTGGTCAG
AAGCCTGGCGGGCGAGAGTGGCGCGGCGAGGAGCAGCGCAGAAACATGGAAACATTCGGACAGGGCAGCGTCGAT
GGCGGATACCGAAACTACCGTGGCCGCGGACGTGGACGAGGCAACCGTGGACGGATCTATTACACCATGCCTGTG
CCCTTTTCTCTCGTCTGCCAGCTCTTGGACGAGTGCCAGCGTCTCTGCAGCGCGGGCAAGTCAAACTCGCGTGCC
GTCGACGAATGGTTTAGGCGGCACCGTGGCTGCATCGATGGCCACGATAGCGAGCCATCTGCGCTCTTGTCGACG
CTGCTGCCGGAGAAGCGGACGGATCGCGTCTATAGCATCCAGGTCACCTCTCTCGAAAGGATGGTTGCGCGAGCC
TTGATGCTCGGCTCCTCGCGCGTCGCCGAACTGGCCAGATACAAGCAGCCCGGTGCTGGACTCGACCTCGCCGAC
TGCGTGGAGCGAATCCTGATAGCCACTCCGAATCCTAGGTGCGTTGGTCTCGATAAAGTCACTGTCGAGGAGTTG
GATTCTCTCCTGCATGGCTTGGCTTCCGGCGTCAGATGGAGCTCCCCTTCGATTCGCAACTCGCCCAAGACAACG
GGTCAGAGCACTCGCGTCGATATTGAGCGAATCTACCGGCGGCTGGAACCGACAGAGGCCAAGTGGTTCACAAGG
CTTATTCTCAAGAACTTTCAGCCCGTCATTCTCGATTCTAGCCTCGTCGTTGGTTGCTGCCATCCTCTGCTACCG
GCAATGCTCAAGATCCGAGACGACTTTTCCGCCGCTATCCGAATGCTTCGTCATGTTCAGGGCGAGTCGTCTTCA
AACTCTGCCTCTGTAGCTTCCAACGACCGCACCGTCCTGTTGTCGCTCAAGCCTCAAGTCGGCATCAAAGTGGGG
AGGCAGGACTGGGTAAAGGGGCGCAGCATCAAGCACTGCTTCGACTTGGGACACGGTCGTATGAGCATTGAGAGG
AAGATTGACGGCGAATATTGCCAGATTCATGTGGATGTCTCTACTGCAACACCTACTCTTCAGATCTTTTCCAAG
AGTGGGAAAGACAGCACCGAGGACAGGAGGGCTGTTCGAGGCGCCATCTACGAGTCTCTACGCATCGGCCGCCCC
GGCTGCGGTTTTCGGTCTAAATGCATTCTCGAGGGCGAGCTTGTCGTTTACAGTCATCGGGAAAAAAAAATTCTT
CCCTTTCACAGAATCAGGAACCACGTCACCCGGAGAGGCGTGTATCTCAACACGGAACAAGATGAACGACCGGAT
GGCAGCGAGGAGTTGATGATGATCTACTTTGATATGCTGCTTCTAGATGACCGATCCCTCCTCCATGTCCGTCGA
TGCGAGAGATTCGAGTTGCTACGGAAGACAGTCCATCCAGTGGTTGGGCGAGCCGAGATCGTTTCGAGACAGCTT
GTCGACTTTGGACATCCCTACGCCGCCTCGGACTTGCGCAACGCCTTTGCCAAGGTAATCGTCGAAAGGGGCGAG
GGTCTCGTGCTCAAGCCGGACGAGCCCTACTTCAACTTCTTCCGCCGAGATTTGCCCTTTCCAGGGCTCTGCATT
AAACTGAAGAAGGAGTACATCGGTAACCTGGGCGAGATAGGAGACTTTGCCGCCGTTGGTGCCGGCTTCGACGCC
TCGAGAGCAAAGATCTACAATGTCCCAAACCTGCGATGGACGCACTTCTACATCGGTTGTCTCGAGAACAAGGAA
CAAGTGCTGAGGTGGAAGGCAACTCCCATCTTTACCGTAGTTGCCGTCGTAGAGCTCAACGCGTCGCAGCTACAG
ACGGTTCACACCTTCGGCTTTCCTTCACCGATGCCTGCTGCGGATAACGAGACGACGAGACTCAAGGTTCCCAAG
GGAATCGAGACGGGTCCGTCACTGACTGTTGCCTTTGGCAACCCGCTTGTTTTCGACATGCGGTGCTTCAGCTTC
GACAGGCCTGGCAACGTGGGCTTCTGGACCTTGAGGTTTCCCTGTGTTTCCAAGATTCATTTCGATCGTGACTTT
CTGGATACGGTTACCTTTGATGAGATGCAGGCTCTGGCAGAGAGCGCGACGACGTCGCCCGAGGCCGAAGACAGC
CAGGAGAATCTCGAGTGGATCGCGAAGCTGGAGAGTGCTGATCCAAAGAGGCCTATTGACGCCGTCACTCAATCG
ACTCAGGCTACAGAGGTGACGCCATCGCCCGACAGGTCGACGCAGAGGACCTGGAATCATGGCTTGGAAGCCTCC
AAGGGTGGTGGTGAGGATGATATGGATTCTCAGGCCACAGCATCTGAAGATGAGGCTGCTTTCTGCGACGAATTG
CCTCGTGTCTCATTTCCCCGCCAGCGAGCGACGCTCGGCTGCGTTCAGAAGCGATGGGCTCCCCTTTCCGATATC
GCGTCACCGACACGCAAAAGGCCGAGGTCGCAGGAGTCCGAGGCGGCATCTCGCCAACCGCTGCTCGACAGGAGT
ACCAACGTCCCGTCGTCTCGCGAGGGCATCTTGCCGGAGATGACGAGGTCCGGGACTCTGCGAGAGGGAGACGAG
GAGCCTATCGCAAGTGAGGAGTCGAGTGTCGAGGCCTGGCGTGCGAAATGGCTCGACTCGCTGGACGCCATCATG
GGAGAGGGCGGAGTGAAGGAAGCGTGCAGATCGAATCCGACGACTCGATGCTCTTACGCCGACGCAAAGTGTCAG
TTGGCCGCCTTTACCGTGTTGGTTTCGTCCATGGCGCTGGTGGACGAGGAGGAGCCGGCGGAGCTGTTGAGGGCT
CACGGCGTGCTTGATACCGTCACCCTGGCGGAGCGGTGGCTCAAGACGGGGAAGAAGACGAGGTCCTCGGTGCAA
GGGTCTAAGGCGGCGAGGGAGCCCGGGAGGAGGAAAGCCAAGCTGATGCTTCTCGTCGACAGCATAGGCAAGGGC
GCGGCCGATGTCAAGGCTCTCGTCGCGCGCATCGGGAAGATGCACAACAGGTCCAGGGGGGGGGGCTGGATCGCT
GTCTATGACTGGCGTGTGCTGAGGAACCTTTCTATCTTGGAGGACGAGGGTCAGTCCAGGAAGTACTATGATGGC
TTCAGTGACCCCTGGCGGAGGTGGCATTGCGGATACTGCTGA
Transcript >Ophcf2|05830
ATGTCAGAGTTTCTTGGGTCACGCATATCCCTCATCTCCAAGAGTGATATTCGCTACGTTGGCACTCTACACGAG
ATCAACTCGGACGAGTCGACGGTGTCTCTCGAAAATGTGCGATCTTTTGGGACTGAGGGCCGCCGGGGCAGAGCC
GAGGACGAGATCGCTCCGTCTGACCAGGTCTACGACTACATCGTCTTCCGAGGCAGCGACGTAAAGGATCTGCGC
ATCGAGGAGCACCCGACTATCAAGGAGAACAAACCTCCACCTGCTATGCCCGATGACCCTGCTATTGTCGGCGCT
CGACCTCGTGAGGCCACATCGGGCCAGGCTGCTCCTCCGGTGACCGGTCACTTCCCGCCCCCATACCCTCCCAAC
AATTTCTATGGTGGACCGCCGCCTCCCGGCTCCTGGGGTCGTGGCGGCGGAGGTCCTATGCCAGGCCCCGGCGGC
GATTTTGGCATGTCGTATCCCCCGCCGCCTCACTGGTTCCCCCACGGTCAAGGGTTCCCGCCGGGCGGCCCGGCT
CCATGGAGTGGCCATCATCCACCGCCAGTCTCGGGAGCTCCCCCAGGTCCCGAAGGCCCGACCCCTCGCCAGCCG
CCACCGGCCGGACCCTTGCAGGACGCCAAGTCCGGTACAGTCGGGCCCGGCCCGGATCGTGTCACGTCGGCGACG
CCCTCGTTCAAGGCTGCTCTCCCGACCGAGCCCAAGCCTCCGGTTCAGGTTGGCCGCCAGACAAGCAAGGCTCCG
AGCCCACCGATAGAATCTAAGCCTTCGGCTGAAGAGGTCAAGGCTGTAGCTACGAGCCTGAGCGGTAACGGGCCT
CTTCCCAATGCTGCTGATCTGCCCAAGCCTACGATTCCTACGGCTCCACGAAACATCAAAATCACACCCGTGATC
CCTCTTTCAGGACCGAGTGCCAAGCCCTTTTCGCTTTCTTCCAGCAGCGGAAAGGTGGACCAACAAGTCGCCGTC
AAGGCCCACGTCGCCGCGGCCCCGGCCAGTGTGGAAGACGCCACGAATGCTGCCCGTGCCGCAGTAGCTGCCGCC
ATGGCTCAGCTCGGCGGCGGAGGTGGCAATGCCATGGACAACCTGACGAACAAGGTCAACGAGATGAGGGTCAAC
GCTGGCCGAGGAGGGACAGCTGGTCGCGCTCGCGGGCGCGGAGGACGGCATGGCACACAGAAGGTCGAGGTTCCG
GACTCGGACTTTGACTTTCAGCAGTCCAACGCAAAGTTCAACCGACACGAGATTGCCAAAGAAGCAATCGCGGGG
TCGCCCATATCGGAGAAGCAGGTGGAGATTACACCGAATACGGAGGTCGAAGCGGTCAACGGCAACCCGGCTGTC
GCGTACAACAAGTCCAGGTCTTTCTTCGATAACATCTCGAGTGAGGCCAAGGACAGGGCGGACAACGGTGGTCAG
AAGCCTGGCGGGCGAGAGTGGCGCGGCGAGGAGCAGCGCAGAAACATGGAAACATTCGGACAGGGCAGCGTCGAT
GGCGGATACCGAAACTACCGTGGCCGCGGACGTGGACGAGGCAACCGTGGACGGATCTATTACACCATGCCTGTG
CCCTTTTCTCTCGTCTGCCAGCTCTTGGACGAGTGCCAGCGTCTCTGCAGCGCGGGCAAGTCAAACTCGCGTGCC
GTCGACGAATGGTTTAGGCGGCACCGTGGCTGCATCGATGGCCACGATAGCGAGCCATCTGCGCTCTTGTCGACG
CTGCTGCCGGAGAAGCGGACGGATCGCGTCTATAGCATCCAGGTCACCTCTCTCGAAAGGATGGTTGCGCGAGCC
TTGATGCTCGGCTCCTCGCGCGTCGCCGAACTGGCCAGATACAAGCAGCCCGGTGCTGGACTCGACCTCGCCGAC
TGCGTGGAGCGAATCCTGATAGCCACTCCGAATCCTAGGTGCGTTGGTCTCGATAAAGTCACTGTCGAGGAGTTG
GATTCTCTCCTGCATGGCTTGGCTTCCGGCGTCAGATGGAGCTCCCCTTCGATTCGCAACTCGCCCAAGACAACG
GGTCAGAGCACTCGCGTCGATATTGAGCGAATCTACCGGCGGCTGGAACCGACAGAGGCCAAGTGGTTCACAAGG
CTTATTCTCAAGAACTTTCAGCCCGTCATTCTCGATTCTAGCCTCGTCGTTGGTTGCTGCCATCCTCTGCTACCG
GCAATGCTCAAGATCCGAGACGACTTTTCCGCCGCTATCCGAATGCTTCGTCATGTTCAGGGCGAGTCGTCTTCA
AACTCTGCCTCTGTAGCTTCCAACGACCGCACCGTCCTGTTGTCGCTCAAGCCTCAAGTCGGCATCAAAGTGGGG
AGGCAGGACTGGGTAAAGGGGCGCAGCATCAAGCACTGCTTCGACTTGGGACACGGTCGTATGAGCATTGAGAGG
AAGATTGACGGCGAATATTGCCAGATTCATGTGGATGTCTCTACTGCAACACCTACTCTTCAGATCTTTTCCAAG
AGTGGGAAAGACAGCACCGAGGACAGGAGGGCTGTTCGAGGCGCCATCTACGAGTCTCTACGCATCGGCCGCCCC
GGCTGCGGTTTTCGGTCTAAATGCATTCTCGAGGGCGAGCTTGTCGTTTACAGTCATCGGGAAAAAAAAATTCTT
CCCTTTCACAGAATCAGGAACCACGTCACCCGGAGAGGCGTGTATCTCAACACGGAACAAGATGAACGACCGGAT
GGCAGCGAGGAGTTGATGATGATCTACTTTGATATGCTGCTTCTAGATGACCGATCCCTCCTCCATGTCCGTCGA
TGCGAGAGATTCGAGTTGCTACGGAAGACAGTCCATCCAGTGGTTGGGCGAGCCGAGATCGTTTCGAGACAGCTT
GTCGACTTTGGACATCCCTACGCCGCCTCGGACTTGCGCAACGCCTTTGCCAAGGTAATCGTCGAAAGGGGCGAG
GGTCTCGTGCTCAAGCCGGACGAGCCCTACTTCAACTTCTTCCGCCGAGATTTGCCCTTTCCAGGGCTCTGCATT
AAACTGAAGAAGGAGTACATCGGTAACCTGGGCGAGATAGGAGACTTTGCCGCCGTTGGTGCCGGCTTCGACGCC
TCGAGAGCAAAGATCTACAATGTCCCAAACCTGCGATGGACGCACTTCTACATCGGTTGTCTCGAGAACAAGGAA
CAAGTGCTGAGGTGGAAGGCAACTCCCATCTTTACCGTAGTTGCCGTCGTAGAGCTCAACGCGTCGCAGCTACAG
ACGGTTCACACCTTCGGCTTTCCTTCACCGATGCCTGCTGCGGATAACGAGACGACGAGACTCAAGGTTCCCAAG
GGAATCGAGACGGGTCCGTCACTGACTGTTGCCTTTGGCAACCCGCTTGTTTTCGACATGCGGTGCTTCAGCTTC
GACAGGCCTGGCAACGTGGGCTTCTGGACCTTGAGGTTTCCCTGTGTTTCCAAGATTCATTTCGATCGTGACTTT
CTGGATACGGTTACCTTTGATGAGATGCAGGCTCTGGCAGAGAGCGCGACGACGTCGCCCGAGGCCGAAGACAGC
CAGGAGAATCTCGAGTGGATCGCGAAGCTGGAGAGTGCTGATCCAAAGAGGCCTATTGACGCCGTCACTCAATCG
ACTCAGGCTACAGAGGTGACGCCATCGCCCGACAGGTCGACGCAGAGGACCTGGAATCATGGCTTGGAAGCCTCC
AAGGGTGGTGGTGAGGATGATATGGATTCTCAGGCCACAGCATCTGAAGATGAGGCTGCTTTCTGCGACGAATTG
CCTCGTGTCTCATTTCCCCGCCAGCGAGCGACGCTCGGCTGCGTTCAGAAGCGATGGGCTCCCCTTTCCGATATC
GCGTCACCGACACGCAAAAGGCCGAGGTCGCAGGAGTCCGAGGCGGCATCTCGCCAACCGCTGCTCGACAGGAGT
ACCAACGTCCCGTCGTCTCGCGAGGGCATCTTGCCGGAGATGACGAGGTCCGGGACTCTGCGAGAGGGAGACGAG
GAGCCTATCGCAAGTGAGGAGTCGAGTGTCGAGGCCTGGCGTGCGAAATGGCTCGACTCGCTGGACGCCATCATG
GGAGAGGGCGGAGTGAAGGAAGCGTGCAGATCGAATCCGACGACTCGATGCTCTTACGCCGACGCAAAGTGTCAG
TTGGCCGCCTTTACCGTGTTGGTTTCGTCCATGGCGCTGGTGGACGAGGAGGAGCCGGCGGAGCTGTTGAGGGCT
CACGGCGTGCTTGATACCGTCACCCTGGCGGAGCGGTGGCTCAAGACGGGGAAGAAGACGAGGTCCTCGGTGCAA
GGGTCTAAGGCGGCGAGGGAGCCCGGGAGGAGGAAAGCCAAGCTGATGCTTCTCGTCGACAGCATAGGCAAGGGC
GCGGCCGATGTCAAGGCTCTCGTCGCGCGCATCGGGAAGATGCACAACAGGTCCAGGGGGGGGGGCTGGATCGCT
GTCTATGACTGGCGTGTGCTGAGGAACCTTTCTATCTTGGAGGACGAGGGTCAGTCCAGGAAGTACTATGATGGC
TTCAGTGACCCCTGGCGGAGGTGGCATTGCGGATACTGCTGA
Gene >Ophcf2|05830
ATGTCAGAGTTTCTTGGGTATGACGCCTGCACTCCTCGCTTATCAGCATTAGCCGTTCGGTCTCGGCTGACTGGA
AACGCATAGGTCACGCATATCCCTCATCTCCAAGAGTGATATTCGGTTTGTTTCCGGACGTTTCCCATCACCAGG
TACTCGAGCTGACGCCCGGCGGCAGCTACGTTGGCACTCTACACGAGATCAACTCGGACGAGTCGACGGTGTCTC
TCGAAAATGTGCGATCTTTTGGGACTGAGGGCCGCCGGGGCAGAGCCGAGGACGAGATCGCTCCGTCTGACCAGG
TCTACGACTACATCGTCTTCCGAGGCAGCGACGTAAAGGATCTGCGCATCGAGGAGCACCCGACTATCAAGGAGA
ACAAACCTCCACCTGCTATGCCCGATGACCCTGCTATTGTCGGCGTAAGTCTTTCCCTGACTCGATTTTCTTCTC
TGGTCTCTGTGTGATGAATTATTTCGGATGTAAAACATTTCATGTCGGAATGCGCAAAACTACATCATGTCGAGA
TTTCCGTTGCCTTCCTTCTGATATGAGACCTCTTACCATCTTCGCTTGACGATTCTTGGCTTCTTCTTGTGCTGA
CAAGAATCACCAGGCTCGACCTCGTGAGGCCACATCGGGCCAGGCTGCTCCTCCGGTGACCGGTCACTTCCCGCC
CCCATACCCTCCCAACAATTTCTATGGTGGACCGCCGCCTCCCGGCTCCTGGGGTCGTGGCGGCGGAGGTCCTAT
GCCAGGCCCCGGCGGCGATTTTGGCATGTCGTATCCCCCGCCGCCTCACTGGTTCCCCCACGGTCAAGGGTTCCC
GCCGGGCGGCCCGGCTCCATGGAGTGGCCATCATCCACCGCCAGTCTCGGGAGCTCCCCCAGGTCCCGAAGGCCC
GACCCCTCGCCAGCCGCCACCGGCCGGACCCTTGCAGGACGCCAAGTCCGGTACAGTCGGGCCCGGCCCGGATCG
TGTCACGTCGGCGACGCCCTCGTTCAAGGCTGCTCTCCCGACCGAGCCCAAGCCTCCGGTTCAGGTTGGCCGCCA
GACAAGCAAGGCTCCGAGCCCACCGATAGAATCTAAGCCTTCGGCTGAAGAGGTCAAGGCTGTAGCTACGAGCCT
GAGCGGTAACGGGCCTCTTCCCAATGCTGCTGATCTGCCCAAGCCTACGATTCCTACGGCTCCACGAAACATCAA
AATCACACCCGTGATCCCTCTTTCAGGACCGAGTGCCAAGCCCTTTTCGCTTTCTTCCAGCAGCGGAAAGGTGGA
CCAACAAGTCGCCGTCAAGGCCCACGTCGCCGCGGCCCCGGCCAGTGTGGAAGACGCCACGAATGCTGCCCGTGC
CGCAGTAGCTGCCGCCATGGCTCAGCTCGGCGGCGGAGGTGGCAATGCCATGGACAACCTGACGAACAAGGTCAA
CGAGATGAGGGTCAACGCTGGCCGAGGAGGGACAGCTGGTCGCGCTCGCGGGCGCGGAGGACGGCATGGCACACA
GAAGGTCGAGGTTCCGGACTCGGACTTTGACTTTCAGCAGTCCAACGCAAAGTTCAACCGACACGAGATTGCCAA
AGAAGCAATCGCGGGGTCGCCCATATCGGAGAAGCAGGTGGAGATTACACCGAATACGGAGGTCGAAGCGGTCAA
CGGCAACCCGGCTGTCGCGTACAACAAGTCCAGGTCTTTCTTCGATAACATCTCGAGTGAGGCCAAGGACAGGGC
GGACAACGGTGGTCAGAAGCCTGGCGGGCGAGAGTGGCGCGGCGAGGAGCAGCGCAGAAACATGGAAACATTCGG
ACAGGGCAGCGTCGATGGCGGATACCGAAACTACCGTGGCCGCGGACGTGGACGAGGCAACCGTGGACGTGGGTA
TGGAAGAGGTCAACGGGGAGGCAACAGACCTCATTTCCAGCCTGCCACGGCCGAATGGTCCTAAATCGAGACGAG
GCGACAGCGGCGGAACGTTGGTTCTCGCGTGTACTTGGAACGGAGATGGGTTAGCAAAAGCACACAACCGTGGGT
TTATATGATTTCGGCGACGGTCGAGAGCGAACAGCGACTCTGCTCTGCGAGACGTGGAGTTTGGATCGGAGGGCG
GACTCTATAGTGATGGGCGGTTTGCGACTTGTCTGTGAGACTCCGGCTGAGGAGAAGACATGGACATGATGAGAG
CGAGCAGTCCATAGGAGAAAAGATGTCAGCAAACATGCCGGCTAATGAGACGTGGCTATGATGAGAGCCGGTTCC
GTTGAGGTGATGGATGAAGAATCAAAGGTGTATGTATTCGTGAAGGGGAGTGACTGATCAAGTCCAGATAGTCAC
GATAGACGAAGTCCGAATATGTATTTGTCTTTATTCATCTCGTCACCGCGATCCGTAGAGTAGAGGAGAGAAGGG
GTTAGTTATCGACGTTGGTTCTCGAATTTGATAAACTACTATAGACACAGAGAGACAGAAGGGAGGGGAGGGAGG
GGTGGACCCGGTTTGGCATGGCCCCGCTAACTGAATCCATAGGCACCTACCTACCTAGGAAAGGCAGGTAGGGGG
GGCGCGTCAAGCCCAAAGCTCTTCCCGTCACGAGTCACGGGTCACGAGTCACGGGTCACGTCTCACGGTCACGTC
TCACGGTCGCGTCTCAGCCGCTGACCGATAACGCGGCTGGACGCGTCACACTCACTTCATCAGTCATCCGAATCC
GGCTTCATTGCGACCTTTCCGCCCTCTGCCTGCCCGGGAAGATGATGCTTGGCGACCCACGCAGGAGCCCTCCTC
GTTGCGGTATCATATCTTCATGGCTCCGTCTTGAAAAAGGTCGGTTCTTTGCCATGATGCCCAGTTGACAGGGAT
CTATTACACCATGCCTGTGCCCTTTTCTCTCGTCTGCCAGCTCTTGGACGAGTGCCAGCGTCTCTGCAGCGCGGG
CAAGTCAAACTCGCGTGCCGTCGACGAATGGTTTAGGCGGCACCGTGGCTGCATCGATGGCCACGATAGCGAGCC
ATCTGCGCTCTTGTCGACGCTGCTGCCGGAGAAGCGGACGGATCGCGTCTATAGCATCCAGGTCACCTCTCTCGA
AAGGATGGTTGCGCGAGCCTTGATGCTCGGCTCCTCGCGCGTCGCCGAACTGGCCAGATACAAGCAGCCCGGTGC
TGGACTCGACCTCGCCGACTGCGTGGAGCGAATCCTGATAGCCACTGTTTGTTACCCTCCCGAAACTGCCAAGAC
TTGCGCTGATGATTCGAGATAGCCGAATCCTAGGTGCGTTGGTCTCGATAAAGTCACTGTCGAGGAGTTGGATTC
TCTCCTGCATGGCTTGGCTTCCGGCGTCAGATGGAGCTCCCCTTCGATTCGCAACTCGCCCAAGACAACGGGTCA
GAGCACTCGCGTCGATATTGAGCGAATCTACCGGCGGCTGGAACCGACAGAGGCCAAGTGGTTCACAAGGCTTAT
TCTCAAGAACTTTCAGCCCGTCATTCTCGATTCTAGCCTCGTCGTTGGTTGCTGCCATCCTCTGCTACCGGCAAT
GCTCAAGATCCGAGACGACTTTTCCGCCGCTATCCGAATGCTTCGTCATGTTCAGGGCGAGTCGTCTTCAAACTC
TGCCTCTGTAGCTTCCAACGACCGCACCGTCCTGTTGTCGCTCAAGCCTCAAGTCGGCATCAAAGTGGGGAGGCA
GGACTGGGTAAAGGGGCGCAGCATCAAGCACTGCTTCGACTTGGGACACGGTCGTATGAGCATTGAGAGGAAGAT
TGACGGCGAATATTGCCAGATTCATGTGGATGTCTCTACTGCAACACCTACTCTTCAGATCTTTTCCAAGAGTGG
GAAAGACAGCACCGAGGACAGGAGGGCTGTTCGAGGGTATCTTTCTCTGGTCGAGTCCCTGATACCGCGCTTTGT
ACTGACGTACGTCTGAAGCGCCATCTACGAGTCTCTACGCATCGGCCGCCCCGGCTGCGGTTTTCGGTCTAAATG
CATTCTCGAGGGCGAGCTTGTCGTTTACAGTCATCGGGTAGGAGGATCTGGCTTTTCTTTTGCTACAGTCGATGC
TGATTCTCGCTACAGGAAAAAAAAATTCTTCCCTTTCACAGAATCAGGAACCACGTCACCCGGAGAGGCGTGTAT
CTCAACACGGAACAAGATGAACGGTATGTCACTATCAATCTGCCTGTCAACGGCCGACTGAAGTCAATAGACCGG
ATGGCAGCGAGGAGTTGATGATGATCTACTTTGATATGCTGCTTCTAGATGACCGATCCCTCCTCCATGTCCGTC
GATGCGAGAGATTCGAGTTGCTACGGAAGACAGTCCATCCAGTGGTTGGGCGAGCCGAGATCGTTTCGAGACAGC
TTGTCGACTTTGGACATCCCTACGCCGCCTCGGACTTGCGCAACGCCTTTGCCAAGGTAATCGTCGAAAGGGGCG
AGGGTCTCGTGCTCAAGCCGGACGAGCCCTACTTCAACTTCTTCCGCCGAGATTTGCCCTTTCCAGGGCTCTGCA
TTAAACTGAAGAAGGAGTACATCGGTAACCTGGGCGAGATAGGAGACTTTGCCGCCGTTGGTGCCGGCTTCGACG
CCTCGAGAGCAAAGATCTACAATGTCCCAAACCTGCGATGGACGCACTTCTACATCGGTTGTCTCGAGAACAAGG
AACAAGTGCTGAGGTGGAAGGCAACTCCCATCTTTACCGTAGTTGCCGTCGTAGAGCTCAACGCGTCGCAGCTAC
AGACGGTTCACACCTTCGGCTTTCCTTCACCGATGCCTGCTGCGGATAACGAGACGACGAGACTCAAGGTTCCCA
AGGGAATCGAGACGGGTCCGTCACTGACTGTTGCCTTTGGCAACCCGCTTGTTTTCGACATGCGGTGCTTCAGCT
TCGACAGGCCTGGCAACGTGGGCTTCTGGACCTTGAGGTTTCCCTGTGTTTCCAAGATTCATTTCGATCGTGACT
TTCTGGATACGGTTACCTTTGATGAGATGCAGGCTCTGGCAGAGAGCGCGACGACGTCGCCCGAGGCCGAAGACA
GCCAGGAGAATCTCGAGTGGATCGCGAAGCTGGAGAGTGCTGATCCAAAGAGGCCTATTGACGCCGTCACTCAAT
CGACTCAGGCTACAGAGGTGACGCCATCGCCCGACAGGTCGACGCAGAGGACCTGGAATCATGGCTTGGAAGCCT
CCAAGGGTGGTGGTGAGGATGATATGGATTCTCAGGCCACAGCATCTGAAGATGAGGCTGCTTTCTGCGACGAAT
TGCCTCGTGTCTCATTTCCCCGCCAGCGAGCGACGCTCGGCTGCGTTCAGAAGCGATGGGCTCCCCTTTCCGATA
TCGCGTCACCGACACGCAAAAGGCCGAGGTCGCAGGAGTCCGAGGCGGCATCTCGCCAACCGCTGCTCGACAGGA
GTACCAACGTCCCGTCGTCTCGCGAGGGCATCTTGCCGGAGATGACGAGGTCCGGGACTCTGCGAGAGGGAGACG
AGGAGCCTATCGCAAGTGAGGAGTCGAGTGTCGAGGCCTGGCGTGCGAAATGGCTCGACTCGCTGGACGCCATCA
TGGGAGAGGGCGGAGTGAAGGAAGCGTGCAGATCGAATCCGACGACTCGATGCTCTTACGCCGACGCAAAGTGTC
AGTTGGCCGCCTTTACCGTGTTGGTTTCGTCCATGGCGCTGGTGGACGAGGAGGAGCCGGCGGAGCTGTTGAGGG
CTCACGGCGTGCTTGATACCGTCACCCTGGCGGAGCGGTGGCTCAAGACGGGGAAGAAGACGAGGTCCTCGGTGC
AAGGGTCTAAGGCGGCGAGGGAGCCCGGGAGGAGGAAAGCCAAGCTGATGCTTCTCGTCGACAGCATAGGCAAGG
GCGCGGCCGATGTCAAGGCTCTCGTCGCGCGCATCGGGAAGATGCACAACAGGTCCAGGGGGGGGGGCTGGATCG
CTGTCTATGACTGGCGTGTGCTGAGGAACCTTTCTATCTTGGAGGACGAGGGTCAGTCCAGGAAGTACTATGATG
GCTTCAGTGACCCCTGGCGGAGGTGGCATTGCGGATACTGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail