Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05829
Gene name
Locationscaffold_06:2360372..2361160
Strand+
Gene length (bp)788
Transcript length (bp)684
Coding sequence length (bp)684
Protein length (aa) 228

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05008 V-SNARE Vesicle transport v-SNARE protein N-terminus 4.6E-21 22 98
PF12352 V-SNARE_C Snare region anchored in the vesicle membrane C-terminus 1.0E-18 135 200

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0006886 intracellular protein transport Yes
GO:0051234 establishment of localization No
GO:0051641 cellular localization No
GO:0110165 cellular anatomical entity No
GO:0070727 cellular macromolecule localization No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0033036 macromolecule localization No
GO:0051649 establishment of localization in cell No
GO:0071702 organic substance transport No
GO:0008104 protein localization No
GO:0015031 protein transport No
GO:0005575 cellular_component No
GO:0071705 nitrogen compound transport No
GO:0045184 establishment of protein localization No
GO:0008150 biological_process No
GO:0046907 intracellular transport No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 59 0.45

Transmembrane Domains

Domain # Start End Length
1 201 223 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05829
MANPLDTDVGSELFGSYEAELKLVQADLSQKLDQIPELSGEPRKSFISQAERALEEADELLGQMRLEKQNIPTAS
RAKANQRFRNYESDVDASRRKLTSLSSDRSALFGSRYRDEPAGASDAHHEQRQQLLSGSDRLDRSTQRLKASQAL
ANETEAIGADTLANLHGQREMIQHTHDRLLSSEGYVDRSVKTLRGMARRMATNRLITIAIITVLVILILAVIISK
FR*
Coding >Ophcf2|05829
ATGGCCAACCCTCTCGACACAGACGTCGGCTCCGAGCTGTTTGGCTCTTATGAAGCCGAACTCAAGCTCGTCCAG
GCCGATCTGTCGCAGAAGCTGGACCAAATCCCCGAACTGTCAGGCGAGCCTCGCAAGTCCTTCATCAGTCAGGCC
GAGAGGGCTCTTGAGGAGGCGGATGAACTGTTGGGGCAGATGCGTCTTGAGAAGCAGAATATACCCACAGCCTCT
CGTGCCAAGGCAAACCAGCGCTTCCGCAACTACGAATCCGACGTCGACGCCAGCAGACGCAAACTTACCTCCCTC
TCTTCCGACCGCTCCGCCCTCTTCGGGTCGCGCTATCGCGACGAGCCAGCCGGCGCATCAGATGCCCATCATGAA
CAGCGCCAGCAGCTCTTGTCTGGTTCGGACCGGCTCGACCGGAGTACGCAGCGATTAAAGGCCAGCCAGGCGCTC
GCCAACGAGACCGAGGCCATCGGCGCCGATACACTCGCAAACCTGCACGGTCAGCGCGAGATGATTCAGCACACC
CACGACCGGCTCCTGAGCAGCGAGGGCTACGTCGACAGGAGTGTCAAGACGTTGCGTGGCATGGCACGGAGGATG
GCCACGAACCGCCTGATTACCATTGCCATCATCACTGTTCTCGTCATCCTCATCTTGGCCGTCATTATCAGCAAA
TTCAGGTGA
Transcript >Ophcf2|05829
ATGGCCAACCCTCTCGACACAGACGTCGGCTCCGAGCTGTTTGGCTCTTATGAAGCCGAACTCAAGCTCGTCCAG
GCCGATCTGTCGCAGAAGCTGGACCAAATCCCCGAACTGTCAGGCGAGCCTCGCAAGTCCTTCATCAGTCAGGCC
GAGAGGGCTCTTGAGGAGGCGGATGAACTGTTGGGGCAGATGCGTCTTGAGAAGCAGAATATACCCACAGCCTCT
CGTGCCAAGGCAAACCAGCGCTTCCGCAACTACGAATCCGACGTCGACGCCAGCAGACGCAAACTTACCTCCCTC
TCTTCCGACCGCTCCGCCCTCTTCGGGTCGCGCTATCGCGACGAGCCAGCCGGCGCATCAGATGCCCATCATGAA
CAGCGCCAGCAGCTCTTGTCTGGTTCGGACCGGCTCGACCGGAGTACGCAGCGATTAAAGGCCAGCCAGGCGCTC
GCCAACGAGACCGAGGCCATCGGCGCCGATACACTCGCAAACCTGCACGGTCAGCGCGAGATGATTCAGCACACC
CACGACCGGCTCCTGAGCAGCGAGGGCTACGTCGACAGGAGTGTCAAGACGTTGCGTGGCATGGCACGGAGGATG
GCCACGAACCGCCTGATTACCATTGCCATCATCACTGTTCTCGTCATCCTCATCTTGGCCGTCATTATCAGCAAA
TTCAGGTGA
Gene >Ophcf2|05829
ATGGCCAACCCTCTCGACACAGACGTCGGCTCCGAGCTGTTTGGCTCTTATGAAGCCGAACTCAAGCTCGTCCAG
GCCGATCTGTCGCAGAAGCTGGACCAAATCCCCGAACTGTCAGGCGAGCCTCGCAAGTCCTTCATCAGTCAGGCC
GAGAGGGCTCTTGAGGAGGCGGATGAACTGGTATGCCGTCTTTACATTTCGCGCGACACCTCGCTAACCCCCCTT
CGCAGTTGGGGCAGATGCGTCTTGAGAAGCAGAATATACCCACAGCCTCTCGTGCCAAGGCAAACCAGCGCTTCC
GCAACTACGAATCCGACGTCGACGCCAGCAGACGCAAACTTACCTCCCTCTCTTCCGACCGCTCCGCCCTCTTCG
GGTCGCGCTATCGCGACGAGCCAGCCGGCGCATCAGATGCCCATCATGAACAGCGCCAGCAGCTCTTGTCTGGTT
CGGACCGGCTCGACCGGAGTACGCAGCGATTAAAGGCCAGCCAGGCGCTCGCCAACGAGACCGAGGCCATCGGCG
CCGATACACTCGCAAACCTGCACGGTCAGCGCGAGATGATTCAGCACACCCACGACCGGCTCCTGAGCAGCGAGG
GCTACGTCGACAGGAGTGTCAAGACGTTGCGTGGCATGGCACGGAGGTAAGAGGTGCGCCGAGCAGCAGTCCCGA
CATCACTGCTGACACGGAGGCGCAGGATGGCCACGAACCGCCTGATTACCATTGCCATCATCACTGTTCTCGTCA
TCCTCATCTTGGCCGTCATTATCAGCAAATTCAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail