Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05827
Gene name
Locationscaffold_06:2356323..2357116
Strand-
Gene length (bp)793
Transcript length (bp)612
Coding sequence length (bp)612
Protein length (aa) 204

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04442 CtaG_Cox11 Cytochrome c oxidase assembly protein CtaG/Cox11 1.1E-59 33 188

GO

GO Term Description Terminal node
GO:0005507 copper ion binding Yes
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 15 34 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05827
MEEMRVYYDHKNKTVAYYMVSLILGTVAFSYGSVPMYKMICQTTGWGGQPIRAHGGSYDGDLASRLQPVTTAKRI
RVTFHASVSDELPWKFVPQQREVRVLPGETALAFYTAENKGDRDIIGVATYSVTPAQCAPYFSKIQCFCFEEQRL
NAGETVDMPVFFYLDPDLLTDLNMRRVETVTLNYTFFKARYDNNGSFKAPATA*
Coding >Ophcf2|05827
ATGGAGGAGATGCGCGTCTATTACGACCATAAGAACAAGACGGTGGCCTACTACATGGTGAGCCTGATACTGGGC
ACCGTGGCCTTTTCCTACGGCTCTGTGCCCATGTACAAGATGATCTGCCAAACCACCGGCTGGGGCGGCCAACCC
ATCCGCGCTCACGGGGGCTCCTACGACGGCGACCTCGCCAGCCGGCTACAGCCCGTAACAACAGCCAAGCGAATC
CGCGTCACCTTCCACGCCTCCGTCTCGGACGAGCTGCCGTGGAAGTTCGTCCCGCAGCAGCGAGAGGTGCGCGTC
CTCCCCGGCGAGACGGCCCTCGCCTTCTACACGGCCGAGAACAAGGGCGACAGGGACATCATCGGCGTGGCGACG
TACAGCGTCACGCCGGCGCAGTGCGCGCCCTACTTTAGCAAGATTCAGTGCTTCTGTTTCGAGGAGCAGAGGCTC
AATGCCGGCGAGACGGTCGATATGCCCGTGTTTTTCTACCTCGATCCCGATCTGCTCACCGATCTCAATATGAGG
CGTGTCGAGACTGTCACCCTCAACTACACCTTCTTCAAGGCGAGATACGACAACAACGGGAGCTTCAAGGCGCCG
GCCACGGCGTGA
Transcript >Ophcf2|05827
ATGGAGGAGATGCGCGTCTATTACGACCATAAGAACAAGACGGTGGCCTACTACATGGTGAGCCTGATACTGGGC
ACCGTGGCCTTTTCCTACGGCTCTGTGCCCATGTACAAGATGATCTGCCAAACCACCGGCTGGGGCGGCCAACCC
ATCCGCGCTCACGGGGGCTCCTACGACGGCGACCTCGCCAGCCGGCTACAGCCCGTAACAACAGCCAAGCGAATC
CGCGTCACCTTCCACGCCTCCGTCTCGGACGAGCTGCCGTGGAAGTTCGTCCCGCAGCAGCGAGAGGTGCGCGTC
CTCCCCGGCGAGACGGCCCTCGCCTTCTACACGGCCGAGAACAAGGGCGACAGGGACATCATCGGCGTGGCGACG
TACAGCGTCACGCCGGCGCAGTGCGCGCCCTACTTTAGCAAGATTCAGTGCTTCTGTTTCGAGGAGCAGAGGCTC
AATGCCGGCGAGACGGTCGATATGCCCGTGTTTTTCTACCTCGATCCCGATCTGCTCACCGATCTCAATATGAGG
CGTGTCGAGACTGTCACCCTCAACTACACCTTCTTCAAGGCGAGATACGACAACAACGGGAGCTTCAAGGCGCCG
GCCACGGCGTGA
Gene >Ophcf2|05827
ATGGAGGAGATGCGCGTCTATTACGACCATAAGAACAAGACGGTGGCGTGGGTGCCATCTCGTTGCGTCTCTGCC
CTGGCTGCGCTCATCCGTCTCGAAGCTACTACATGGTGAGCCTGATACTGGGCACCGTGGCCTTTTCCTACGGCT
CTGTGCCCATGTACAAGATGGTGCTTCAACCCCCTCCCCCCCCCTTCTGTCTCTTCAAACCAGCAGCTGAACGAC
ACGACGACACGAACAGATCTGCCAAACCACCGGCTGGGGCGGCCAACCCATCCGCGCTCACGGGGGCTCCTACGA
CGGCGACCTCGCCAGCCGGCTACAGCCCGTAACAACAGCCAAGCGAATCCGCGTCACCTTCCACGCCTCCGTCTC
GGACGAGCTGCCGTGGAAGTTCGTCCCGCAGCAGCGAGAGGTGCGCGTCCTCCCCGGCGAGACGGCCCTCGCCTT
CTACACGGCCGAGAACAAGGGCGACAGGGACATCATCGGCGTGGCGACGTACAGCGTCACGCCGGCGCAGTGCGC
GCCCTACTTTAGCAAGATTCAGTGCTTCTGTTTCGAGGAGCAGAGGCTCAATGCCGGCGAGACGGTCGATATGCC
CGTGTTTTTCTACCTCGATCCCGATCTGCTCACCGATCTCAATATGAGGCGTGTCGAGACTGTCACCCTCAACTA
CACCTTCTTCAGTACGTCGACGCTTGTTCTTTTTTGCACCTGTTGCGCGCTACTGACGTTGGAAGCAGAGGCGAG
ATACGACAACAACGGGAGCTTCAAGGCGCCGGCCACGGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail