Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05821
Gene name
Locationscaffold_06:2339333..2339824
Strand-
Gene length (bp)491
Transcript length (bp)432
Coding sequence length (bp)432
Protein length (aa) 144

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4 1.1E-20 11 125

GO

GO Term Description Terminal node
GO:0006352 DNA-templated transcription, initiation Yes
GO:0030880 RNA polymerase complex Yes
GO:1901360 organic cyclic compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0032991 protein-containing complex No
GO:0043170 macromolecule metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0008152 metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009987 cellular process No
GO:1990234 transferase complex No
GO:0071704 organic substance metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0005575 cellular_component No
GO:0006807 nitrogen compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0061695 transferase complex, transferring phosphorus-containing groups No
GO:0044249 cellular biosynthetic process No
GO:0140535 intracellular protein-containing complex No
GO:0019438 aromatic compound biosynthetic process No
GO:0008150 biological_process No
GO:1902494 catalytic complex No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.6198 0.7597 0.026 0.0632 0.2993 0.0032 0.0195 0.0969 0.0226 0.0114

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 265.47 148.93 382.01
Alive In ants, during behavior modification 153.34 74.57 232.11
Dead In ants, recently dead 139.09 70.70 207.47

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.007612 yes
Alive Dead 0.657926 no
Dead Fungus 0.000657 yes

Orthologs

Orthofinder run ID4
Orthogroup1564
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6594
Ophiocordyceps australis map64 (Brazil) OphauB2|6122
Ophiocordyceps camponoti-floridani Ophcf2|05821 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|738
Ophiocordyceps kimflemingae Ophio5|5763
Ophiocordyceps subramaniannii Hirsu2|1147

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05821
MRIVESQSAVLTNYEVFQHLVDQRRRYQPTKRRGPGNLETVVKEVLVYMRERPSPLCQEPVTYKAECVARLLERL
RPYDLSKGEVIMMFNHRPPDVAHLNTLVEDMSDRFSPEQQQEIVHVVADVLGRLDDGEQQTDTGAAAA*
Coding >Ophcf2|05821
ATGCGAATCGTCGAGTCTCAATCGGCCGTCCTCACAAACTACGAGGTCTTTCAGCACCTCGTCGACCAGCGTCGC
CGCTACCAGCCCACCAAGCGTCGCGGGCCTGGGAACCTGGAAACGGTCGTCAAGGAGGTGCTGGTTTATATGCGC
GAGCGGCCCAGTCCCTTGTGTCAGGAGCCCGTCACGTACAAGGCCGAGTGCGTCGCTCGACTGCTGGAGAGGTTG
CGGCCGTATGACCTGTCCAAGGGCGAGGTCATCATGATGTTCAATCATCGGCCTCCTGACGTTGCTCATCTCAAC
ACCCTGGTTGAGGATATGTCGGATCGCTTCTCCCCTGAGCAGCAGCAGGAGATTGTCCATGTCGTCGCCGACGTT
CTCGGTCGCCTTGATGACGGTGAACAGCAGACAGACACGGGGGCTGCCGCCGCCTGA
Transcript >Ophcf2|05821
ATGCGAATCGTCGAGTCTCAATCGGCCGTCCTCACAAACTACGAGGTCTTTCAGCACCTCGTCGACCAGCGTCGC
CGCTACCAGCCCACCAAGCGTCGCGGGCCTGGGAACCTGGAAACGGTCGTCAAGGAGGTGCTGGTTTATATGCGC
GAGCGGCCCAGTCCCTTGTGTCAGGAGCCCGTCACGTACAAGGCCGAGTGCGTCGCTCGACTGCTGGAGAGGTTG
CGGCCGTATGACCTGTCCAAGGGCGAGGTCATCATGATGTTCAATCATCGGCCTCCTGACGTTGCTCATCTCAAC
ACCCTGGTTGAGGATATGTCGGATCGCTTCTCCCCTGAGCAGCAGCAGGAGATTGTCCATGTCGTCGCCGACGTT
CTCGGTCGCCTTGATGACGGTGAACAGCAGACAGACACGGGGGCTGCCGCCGCCTGA
Gene >Ophcf2|05821
ATGCGAATCGTCGAGTCTCAATCGGCCGTCCTCACAAACTACGAGGTCTTTCAGCACCTCGTCGACCAGCGTCGC
CGCTACCAGCCCACCAAGCGTCGCGGGCCTGGGAACCTGGAAACGGTCGTCAAGGAGGTTCGTCCATCGTAAACG
CCTCCTCTCTGGACGGGAGCTGATTCTCGCGGCTCATCAAGGTGCTGGTTTATATGCGCGAGCGGCCCAGTCCCT
TGTGTCAGGAGCCCGTCACGTACAAGGCCGAGTGCGTCGCTCGACTGCTGGAGAGGTTGCGGCCGTATGACCTGT
CCAAGGGCGAGGTCATCATGATGTTCAATCATCGGCCTCCTGACGTTGCTCATCTCAACACCCTGGTTGAGGATA
TGTCGGATCGCTTCTCCCCTGAGCAGCAGCAGGAGATTGTCCATGTCGTCGCCGACGTTCTCGGTCGCCTTGATG
ACGGTGAACAGCAGACAGACACGGGGGCTGCCGCCGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail