Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05821
Gene name
Locationscaffold_06:2339333..2339824
Strand-
Gene length (bp)491
Transcript length (bp)432
Coding sequence length (bp)432
Protein length (aa) 144

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4 1.1E-20 11 125

GO

GO Term Description Terminal node
GO:0006352 DNA-templated transcription, initiation Yes
GO:0030880 RNA polymerase complex Yes
GO:1901360 organic cyclic compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0032991 protein-containing complex No
GO:0043170 macromolecule metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0008152 metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009987 cellular process No
GO:1990234 transferase complex No
GO:0071704 organic substance metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0005575 cellular_component No
GO:0006807 nitrogen compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0061695 transferase complex, transferring phosphorus-containing groups No
GO:0044249 cellular biosynthetic process No
GO:0140535 intracellular protein-containing complex No
GO:0019438 aromatic compound biosynthetic process No
GO:0008150 biological_process No
GO:1902494 catalytic complex No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.6198 0.7597 0.026 0.0632 0.2993 0.0032 0.0195 0.0969 0.0226 0.0114

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1564
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6594
Ophiocordyceps australis map64 (Brazil) OphauB2|6122
Ophiocordyceps camponoti-floridani Ophcf2|05821 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|738
Ophiocordyceps kimflemingae Ophio5|5763
Ophiocordyceps subramaniannii Hirsu2|1147

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05821
MRIVESQSAVLTNYEVFQHLVDQRRRYQPTKRRGPGNLETVVKEVLVYMRERPSPLCQEPVTYKAECVARLLERL
RPYDLSKGEVIMMFNHRPPDVAHLNTLVEDMSDRFSPEQQQEIVHVVADVLGRLDDGEQQTDTGAAAA*
Coding >Ophcf2|05821
ATGCGAATCGTCGAGTCTCAATCGGCCGTCCTCACAAACTACGAGGTCTTTCAGCACCTCGTCGACCAGCGTCGC
CGCTACCAGCCCACCAAGCGTCGCGGGCCTGGGAACCTGGAAACGGTCGTCAAGGAGGTGCTGGTTTATATGCGC
GAGCGGCCCAGTCCCTTGTGTCAGGAGCCCGTCACGTACAAGGCCGAGTGCGTCGCTCGACTGCTGGAGAGGTTG
CGGCCGTATGACCTGTCCAAGGGCGAGGTCATCATGATGTTCAATCATCGGCCTCCTGACGTTGCTCATCTCAAC
ACCCTGGTTGAGGATATGTCGGATCGCTTCTCCCCTGAGCAGCAGCAGGAGATTGTCCATGTCGTCGCCGACGTT
CTCGGTCGCCTTGATGACGGTGAACAGCAGACAGACACGGGGGCTGCCGCCGCCTGA
Transcript >Ophcf2|05821
ATGCGAATCGTCGAGTCTCAATCGGCCGTCCTCACAAACTACGAGGTCTTTCAGCACCTCGTCGACCAGCGTCGC
CGCTACCAGCCCACCAAGCGTCGCGGGCCTGGGAACCTGGAAACGGTCGTCAAGGAGGTGCTGGTTTATATGCGC
GAGCGGCCCAGTCCCTTGTGTCAGGAGCCCGTCACGTACAAGGCCGAGTGCGTCGCTCGACTGCTGGAGAGGTTG
CGGCCGTATGACCTGTCCAAGGGCGAGGTCATCATGATGTTCAATCATCGGCCTCCTGACGTTGCTCATCTCAAC
ACCCTGGTTGAGGATATGTCGGATCGCTTCTCCCCTGAGCAGCAGCAGGAGATTGTCCATGTCGTCGCCGACGTT
CTCGGTCGCCTTGATGACGGTGAACAGCAGACAGACACGGGGGCTGCCGCCGCCTGA
Gene >Ophcf2|05821
ATGCGAATCGTCGAGTCTCAATCGGCCGTCCTCACAAACTACGAGGTCTTTCAGCACCTCGTCGACCAGCGTCGC
CGCTACCAGCCCACCAAGCGTCGCGGGCCTGGGAACCTGGAAACGGTCGTCAAGGAGGTTCGTCCATCGTAAACG
CCTCCTCTCTGGACGGGAGCTGATTCTCGCGGCTCATCAAGGTGCTGGTTTATATGCGCGAGCGGCCCAGTCCCT
TGTGTCAGGAGCCCGTCACGTACAAGGCCGAGTGCGTCGCTCGACTGCTGGAGAGGTTGCGGCCGTATGACCTGT
CCAAGGGCGAGGTCATCATGATGTTCAATCATCGGCCTCCTGACGTTGCTCATCTCAACACCCTGGTTGAGGATA
TGTCGGATCGCTTCTCCCCTGAGCAGCAGCAGGAGATTGTCCATGTCGTCGCCGACGTTCTCGGTCGCCTTGATG
ACGGTGAACAGCAGACAGACACGGGGGCTGCCGCCGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail