Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05820
Gene name
Locationscaffold_06:2337376..2338897
Strand-
Gene length (bp)1521
Transcript length (bp)1521
Coding sequence length (bp)1521
Protein length (aa) 507

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01416 PseudoU_synth_1 tRNA pseudouridine synthase 4.8E-32 230 353

GO

GO Term Description Terminal node
GO:0009451 RNA modification Yes
GO:0001522 pseudouridine synthesis Yes
GO:0003723 RNA binding Yes
GO:0009982 pseudouridine synthase activity Yes
GO:0003824 catalytic activity No
GO:0097159 organic cyclic compound binding No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0005488 binding No
GO:0043170 macromolecule metabolic process No
GO:0016866 intramolecular transferase activity No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0043412 macromolecule modification No
GO:0008150 biological_process No
GO:0016853 isomerase activity No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.515 0.661 0.0439 0.0348 0.3418 0.0009 0.0827 0.0415 0.0899 0.0026

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1563
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6596
Ophiocordyceps australis map64 (Brazil) OphauB2|6124
Ophiocordyceps camponoti-floridani Ophcf2|05820 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|739
Ophiocordyceps kimflemingae Ophio5|5761
Ophiocordyceps subramaniannii Hirsu2|1145

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05820
MADSNYESWTRTGLIKRLRELEAELKTRPPSAEEEEIIAPLPTKAKPAFDPSRYSTRFIALKLAYLGKRYGGFEF
QALGNQPTIEEELWKALCKACLIFPDGHVDAVQFDCCQYSKCGRTDRGVSAFGQVISLRVRSNRPLEVRRERDGE
EEEEEEEEETPPFDDMADELCYPRILNRILPPDIRILAWCPSPPADFSARFSCRERQYRYFFTQPAFAGGRLDIA
AMRDAAKRFEGEHDFRNLCKVDPAKQITNFRRRILEADVVEMHDSRAFMPFDGTGTGADGKVYYFLVRGTAFLWH
QIRHMVAVLFLVGQGFEKPSVVSQLLDVDATPRKPAYVMADEVPLVLWDCAYPDLEKLEASAQTNRVEDSLRWIY
VGDDAPADKFGLHGVVDRLWRLWRECKMDELLAGELLQLVATQGAMQRRGEEKDLRRKVGTTMFEGGNSGRLAGK
YVALSNRRMLESPEEQNERYAKRKGYASAQDMRMQKSTEREAKAAAKTKAETTGDG*
Coding >Ophcf2|05820
ATGGCCGATAGCAACTACGAGAGCTGGACGCGGACGGGCCTCATCAAGCGACTCCGGGAGCTCGAGGCCGAGTTG
AAGACGCGCCCTCCGTCGGCCGAGGAGGAGGAGATCATCGCCCCTCTGCCGACCAAGGCGAAGCCCGCCTTCGAT
CCGTCCCGCTATTCGACGCGCTTCATCGCCCTCAAGCTCGCCTACCTCGGTAAGCGCTATGGCGGCTTCGAGTTC
CAGGCCTTGGGGAACCAGCCGACCATCGAGGAGGAGCTGTGGAAGGCGCTATGCAAGGCCTGTCTCATCTTTCCA
GATGGCCACGTTGATGCCGTCCAGTTCGACTGCTGCCAATACTCCAAGTGTGGCCGAACCGATCGCGGTGTCAGT
GCCTTTGGCCAGGTCATCAGTCTGCGCGTGCGGAGCAACAGACCGCTCGAGGTCCGTCGAGAGAGAGACGGCGAG
GAGGAAGAGGAGGAGGAGGAGGAGGAGACGCCGCCTTTCGACGACATGGCCGACGAGCTCTGCTACCCGCGCATC
CTCAACCGCATCCTCCCGCCCGATATCCGCATCCTGGCCTGGTGTCCCTCGCCGCCGGCCGACTTCTCCGCTCGC
TTCTCGTGTCGCGAGCGCCAGTACCGATACTTCTTCACCCAGCCGGCCTTTGCTGGCGGCCGGCTAGACATTGCG
GCGATGCGCGACGCGGCCAAGCGCTTCGAGGGTGAGCACGACTTTCGCAACCTGTGCAAGGTCGACCCGGCCAAG
CAAATCACAAACTTTCGCCGGCGAATCCTCGAGGCTGACGTCGTCGAGATGCATGATTCCCGCGCCTTCATGCCC
TTTGACGGCACCGGGACGGGAGCCGACGGCAAGGTATATTACTTTCTGGTCCGAGGCACGGCCTTTCTGTGGCAT
CAGATCCGCCACATGGTCGCCGTCCTGTTCCTCGTGGGTCAGGGGTTCGAGAAGCCGAGTGTCGTGTCGCAGCTG
CTCGACGTGGATGCCACCCCGCGCAAGCCGGCGTACGTCATGGCCGACGAAGTTCCGCTCGTGCTGTGGGATTGC
GCCTATCCAGACTTGGAGAAGCTGGAGGCGAGTGCGCAGACGAATAGGGTCGAGGACTCGCTGCGGTGGATTTAC
GTCGGTGATGATGCGCCGGCCGACAAATTCGGCCTGCACGGAGTCGTCGACCGGCTGTGGCGGCTGTGGCGCGAG
TGTAAGATGGACGAGCTGCTGGCGGGAGAATTGCTGCAGCTGGTCGCGACCCAAGGGGCGATGCAGCGGCGAGGC
GAAGAAAAGGACCTGAGGCGCAAAGTCGGCACCACCATGTTCGAGGGAGGCAACAGCGGAAGGCTGGCCGGCAAG
TACGTGGCGTTGTCGAACAGGAGAATGTTGGAGTCGCCGGAAGAGCAGAATGAAAGATATGCCAAGCGCAAGGGA
TATGCGAGTGCCCAAGACATGCGGATGCAGAAGAGCACGGAGCGGGAGGCAAAGGCGGCGGCAAAGACGAAGGCG
GAGACGACGGGGGATGGGTAG
Transcript >Ophcf2|05820
ATGGCCGATAGCAACTACGAGAGCTGGACGCGGACGGGCCTCATCAAGCGACTCCGGGAGCTCGAGGCCGAGTTG
AAGACGCGCCCTCCGTCGGCCGAGGAGGAGGAGATCATCGCCCCTCTGCCGACCAAGGCGAAGCCCGCCTTCGAT
CCGTCCCGCTATTCGACGCGCTTCATCGCCCTCAAGCTCGCCTACCTCGGTAAGCGCTATGGCGGCTTCGAGTTC
CAGGCCTTGGGGAACCAGCCGACCATCGAGGAGGAGCTGTGGAAGGCGCTATGCAAGGCCTGTCTCATCTTTCCA
GATGGCCACGTTGATGCCGTCCAGTTCGACTGCTGCCAATACTCCAAGTGTGGCCGAACCGATCGCGGTGTCAGT
GCCTTTGGCCAGGTCATCAGTCTGCGCGTGCGGAGCAACAGACCGCTCGAGGTCCGTCGAGAGAGAGACGGCGAG
GAGGAAGAGGAGGAGGAGGAGGAGGAGACGCCGCCTTTCGACGACATGGCCGACGAGCTCTGCTACCCGCGCATC
CTCAACCGCATCCTCCCGCCCGATATCCGCATCCTGGCCTGGTGTCCCTCGCCGCCGGCCGACTTCTCCGCTCGC
TTCTCGTGTCGCGAGCGCCAGTACCGATACTTCTTCACCCAGCCGGCCTTTGCTGGCGGCCGGCTAGACATTGCG
GCGATGCGCGACGCGGCCAAGCGCTTCGAGGGTGAGCACGACTTTCGCAACCTGTGCAAGGTCGACCCGGCCAAG
CAAATCACAAACTTTCGCCGGCGAATCCTCGAGGCTGACGTCGTCGAGATGCATGATTCCCGCGCCTTCATGCCC
TTTGACGGCACCGGGACGGGAGCCGACGGCAAGGTATATTACTTTCTGGTCCGAGGCACGGCCTTTCTGTGGCAT
CAGATCCGCCACATGGTCGCCGTCCTGTTCCTCGTGGGTCAGGGGTTCGAGAAGCCGAGTGTCGTGTCGCAGCTG
CTCGACGTGGATGCCACCCCGCGCAAGCCGGCGTACGTCATGGCCGACGAAGTTCCGCTCGTGCTGTGGGATTGC
GCCTATCCAGACTTGGAGAAGCTGGAGGCGAGTGCGCAGACGAATAGGGTCGAGGACTCGCTGCGGTGGATTTAC
GTCGGTGATGATGCGCCGGCCGACAAATTCGGCCTGCACGGAGTCGTCGACCGGCTGTGGCGGCTGTGGCGCGAG
TGTAAGATGGACGAGCTGCTGGCGGGAGAATTGCTGCAGCTGGTCGCGACCCAAGGGGCGATGCAGCGGCGAGGC
GAAGAAAAGGACCTGAGGCGCAAAGTCGGCACCACCATGTTCGAGGGAGGCAACAGCGGAAGGCTGGCCGGCAAG
TACGTGGCGTTGTCGAACAGGAGAATGTTGGAGTCGCCGGAAGAGCAGAATGAAAGATATGCCAAGCGCAAGGGA
TATGCGAGTGCCCAAGACATGCGGATGCAGAAGAGCACGGAGCGGGAGGCAAAGGCGGCGGCAAAGACGAAGGCG
GAGACGACGGGGGATGGGTAG
Gene >Ophcf2|05820
ATGGCCGATAGCAACTACGAGAGCTGGACGCGGACGGGCCTCATCAAGCGACTCCGGGAGCTCGAGGCCGAGTTG
AAGACGCGCCCTCCGTCGGCCGAGGAGGAGGAGATCATCGCCCCTCTGCCGACCAAGGCGAAGCCCGCCTTCGAT
CCGTCCCGCTATTCGACGCGCTTCATCGCCCTCAAGCTCGCCTACCTCGGTAAGCGCTATGGCGGCTTCGAGTTC
CAGGCCTTGGGGAACCAGCCGACCATCGAGGAGGAGCTGTGGAAGGCGCTATGCAAGGCCTGTCTCATCTTTCCA
GATGGCCACGTTGATGCCGTCCAGTTCGACTGCTGCCAATACTCCAAGTGTGGCCGAACCGATCGCGGTGTCAGT
GCCTTTGGCCAGGTCATCAGTCTGCGCGTGCGGAGCAACAGACCGCTCGAGGTCCGTCGAGAGAGAGACGGCGAG
GAGGAAGAGGAGGAGGAGGAGGAGGAGACGCCGCCTTTCGACGACATGGCCGACGAGCTCTGCTACCCGCGCATC
CTCAACCGCATCCTCCCGCCCGATATCCGCATCCTGGCCTGGTGTCCCTCGCCGCCGGCCGACTTCTCCGCTCGC
TTCTCGTGTCGCGAGCGCCAGTACCGATACTTCTTCACCCAGCCGGCCTTTGCTGGCGGCCGGCTAGACATTGCG
GCGATGCGCGACGCGGCCAAGCGCTTCGAGGGTGAGCACGACTTTCGCAACCTGTGCAAGGTCGACCCGGCCAAG
CAAATCACAAACTTTCGCCGGCGAATCCTCGAGGCTGACGTCGTCGAGATGCATGATTCCCGCGCCTTCATGCCC
TTTGACGGCACCGGGACGGGAGCCGACGGCAAGGTATATTACTTTCTGGTCCGAGGCACGGCCTTTCTGTGGCAT
CAGATCCGCCACATGGTCGCCGTCCTGTTCCTCGTGGGTCAGGGGTTCGAGAAGCCGAGTGTCGTGTCGCAGCTG
CTCGACGTGGATGCCACCCCGCGCAAGCCGGCGTACGTCATGGCCGACGAAGTTCCGCTCGTGCTGTGGGATTGC
GCCTATCCAGACTTGGAGAAGCTGGAGGCGAGTGCGCAGACGAATAGGGTCGAGGACTCGCTGCGGTGGATTTAC
GTCGGTGATGATGCGCCGGCCGACAAATTCGGCCTGCACGGAGTCGTCGACCGGCTGTGGCGGCTGTGGCGCGAG
TGTAAGATGGACGAGCTGCTGGCGGGAGAATTGCTGCAGCTGGTCGCGACCCAAGGGGCGATGCAGCGGCGAGGC
GAAGAAAAGGACCTGAGGCGCAAAGTCGGCACCACCATGTTCGAGGGAGGCAACAGCGGAAGGCTGGCCGGCAAG
TACGTGGCGTTGTCGAACAGGAGAATGTTGGAGTCGCCGGAAGAGCAGAATGAAAGATATGCCAAGCGCAAGGGA
TATGCGAGTGCCCAAGACATGCGGATGCAGAAGAGCACGGAGCGGGAGGCAAAGGCGGCGGCAAAGACGAAGGCG
GAGACGACGGGGGATGGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail