Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05819
Gene name
Locationscaffold_06:2336921..2337334
Strand+
Gene length (bp)413
Transcript length (bp)333
Coding sequence length (bp)333
Protein length (aa) 111

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10181 PIG-H GPI-GlcNAc transferase complex, PIG-H component 3.1E-27 6 71

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole 0.2977 0.3842 0.0433 0.3627 0.317 0.0316 0.2705 0.5105 0.2767 0.0674

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 20.79 4.10 37.48
Alive In ants, during behavior modification 11.50 1.00 22.01
Dead In ants, recently dead 10.63 0.21 21.06

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.112280 no
Alive Dead 0.863128 no
Dead Fungus 0.096938 no

Orthologs

Orthofinder run ID4
Orthogroup6025
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6597
Ophiocordyceps australis map64 (Brazil) OphauB2|6125
Ophiocordyceps camponoti-floridani Ophcf2|05819 (this protein)
Ophiocordyceps kimflemingae Ophio5|5760
Ophiocordyceps subramaniannii Hirsu2|1144

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05819
MHARESLLVLRGLGVQTTEQSSSYLTRPATRFIPTEKIQDIFINEAFRGFQVRYYLVVVVEAEPDVVVVFPGLLP
PRHIVEAVWRGTRECLYEGRAEEKAVPQQNHGLPQ*
Coding >Ophcf2|05819
ATGCATGCTCGAGAGTCGCTGCTCGTTTTGCGTGGCTTGGGCGTTCAGACCACGGAGCAGTCGTCGTCTTACTTG
ACTCGTCCTGCTACCCGCTTCATCCCTACGGAAAAGATTCAGGACATCTTCATCAACGAGGCCTTTCGCGGCTTC
CAAGTCCGCTACTATCTCGTCGTCGTCGTCGAGGCCGAACCCGATGTCGTCGTCGTCTTTCCGGGACTCTTGCCC
CCGAGGCACATCGTCGAGGCCGTCTGGAGGGGCACGCGCGAGTGTCTGTACGAAGGCCGTGCCGAGGAAAAGGCC
GTGCCTCAGCAAAACCACGGGTTGCCGCAATAG
Transcript >Ophcf2|05819
ATGCATGCTCGAGAGTCGCTGCTCGTTTTGCGTGGCTTGGGCGTTCAGACCACGGAGCAGTCGTCGTCTTACTTG
ACTCGTCCTGCTACCCGCTTCATCCCTACGGAAAAGATTCAGGACATCTTCATCAACGAGGCCTTTCGCGGCTTC
CAAGTCCGCTACTATCTCGTCGTCGTCGTCGAGGCCGAACCCGATGTCGTCGTCGTCTTTCCGGGACTCTTGCCC
CCGAGGCACATCGTCGAGGCCGTCTGGAGGGGCACGCGCGAGTGTCTGTACGAAGGCCGTGCCGAGGAAAAGGCC
GTGCCTCAGCAAAACCACGGGTTGCCGCAATAG
Gene >Ophcf2|05819
ATGCATGCTCGAGAGTCGCTGCTCGTTTTGCGTGGCTTGGGCGTTCAGACCACGGAGCAGTCGTCGTCTTACTTG
ACTCGTCCTGCTACCCGCTTCATCCCTACGGAAAAGATTCAGGACATCTTCATCAACGAGGCCTTTCGCGGCTTC
CAAGTCCGCTACTATCTCGTCGTCGTCGTCGAGGCCGAACCCGATGTCGTCGTCGTCTTTCCGGGACTCTTGCCC
CCGAGGCACATCGTCGAGGCCGTCTGGAGGGGCACGCGCGAGTGTCTGTACGAAGGCCGTGCCGAGGAAAAGGCC
GTGCCTCAGCAGTCCGTCTCTCCCTTCTCTCCTCTTGACTCCGTGCTATACCTGCCTTTGCTATTCGCTACTGAC
GCCGAGCCGTCGCTAGAAACCACGGGTTGCCGCAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail