Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05819
Gene name
Locationscaffold_06:2336921..2337334
Strand+
Gene length (bp)413
Transcript length (bp)333
Coding sequence length (bp)333
Protein length (aa) 111

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10181 PIG-H GPI-GlcNAc transferase complex, PIG-H component 3.1E-27 6 71

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole 0.2977 0.3842 0.0433 0.3627 0.317 0.0316 0.2705 0.5105 0.2767 0.0674

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6025
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6597
Ophiocordyceps australis map64 (Brazil) OphauB2|6125
Ophiocordyceps camponoti-floridani Ophcf2|05819 (this protein)
Ophiocordyceps kimflemingae Ophio5|5760
Ophiocordyceps subramaniannii Hirsu2|1144

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05819
MHARESLLVLRGLGVQTTEQSSSYLTRPATRFIPTEKIQDIFINEAFRGFQVRYYLVVVVEAEPDVVVVFPGLLP
PRHIVEAVWRGTRECLYEGRAEEKAVPQQNHGLPQ*
Coding >Ophcf2|05819
ATGCATGCTCGAGAGTCGCTGCTCGTTTTGCGTGGCTTGGGCGTTCAGACCACGGAGCAGTCGTCGTCTTACTTG
ACTCGTCCTGCTACCCGCTTCATCCCTACGGAAAAGATTCAGGACATCTTCATCAACGAGGCCTTTCGCGGCTTC
CAAGTCCGCTACTATCTCGTCGTCGTCGTCGAGGCCGAACCCGATGTCGTCGTCGTCTTTCCGGGACTCTTGCCC
CCGAGGCACATCGTCGAGGCCGTCTGGAGGGGCACGCGCGAGTGTCTGTACGAAGGCCGTGCCGAGGAAAAGGCC
GTGCCTCAGCAAAACCACGGGTTGCCGCAATAG
Transcript >Ophcf2|05819
ATGCATGCTCGAGAGTCGCTGCTCGTTTTGCGTGGCTTGGGCGTTCAGACCACGGAGCAGTCGTCGTCTTACTTG
ACTCGTCCTGCTACCCGCTTCATCCCTACGGAAAAGATTCAGGACATCTTCATCAACGAGGCCTTTCGCGGCTTC
CAAGTCCGCTACTATCTCGTCGTCGTCGTCGAGGCCGAACCCGATGTCGTCGTCGTCTTTCCGGGACTCTTGCCC
CCGAGGCACATCGTCGAGGCCGTCTGGAGGGGCACGCGCGAGTGTCTGTACGAAGGCCGTGCCGAGGAAAAGGCC
GTGCCTCAGCAAAACCACGGGTTGCCGCAATAG
Gene >Ophcf2|05819
ATGCATGCTCGAGAGTCGCTGCTCGTTTTGCGTGGCTTGGGCGTTCAGACCACGGAGCAGTCGTCGTCTTACTTG
ACTCGTCCTGCTACCCGCTTCATCCCTACGGAAAAGATTCAGGACATCTTCATCAACGAGGCCTTTCGCGGCTTC
CAAGTCCGCTACTATCTCGTCGTCGTCGTCGAGGCCGAACCCGATGTCGTCGTCGTCTTTCCGGGACTCTTGCCC
CCGAGGCACATCGTCGAGGCCGTCTGGAGGGGCACGCGCGAGTGTCTGTACGAAGGCCGTGCCGAGGAAAAGGCC
GTGCCTCAGCAGTCCGTCTCTCCCTTCTCTCCTCTTGACTCCGTGCTATACCTGCCTTTGCTATTCGCTACTGAC
GCCGAGCCGTCGCTAGAAACCACGGGTTGCCGCAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail