Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05810
Gene name
Locationscaffold_06:2310153..2311253
Strand-
Gene length (bp)1100
Transcript length (bp)1047
Coding sequence length (bp)1047
Protein length (aa) 349

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16543 DFRP_C DRG Family Regulatory Proteins, Tma46 3.7E-27 239 320
PF00642 zf-CCCH Zinc finger C-x8-C-x5-C-x3-H type (and similar) 1.0E-05 98 122

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3159 0.7138 0.0094 0.0349 0.0928 0.0036 0.0531 0.0113 0.0529 0.0001

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2815
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|937
Ophiocordyceps australis map64 (Brazil) OphauB2|6132
Ophiocordyceps camponoti-floridani Ophcf2|05810 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6219
Ophiocordyceps kimflemingae Ophio5|6327
Ophiocordyceps subramaniannii Hirsu2|4540

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05810
MPPKKAEKAAGGKKPSASKMVEDRTFGMKNKKGAVAQKQIAQMATNLKAGGSAEEKRKAAEKAAREREKKAAEDA
RKEAAALLNRPAQIQKVPFGVDPKTVVCIFYKKGDCEKGKKCKFSHDLSIERKTEKKNLYSDTRKEDEEEAEETK
KQETSADWDEEQLRKVVLSKKGNQRTTTEKVCKFFISAIEDGKYGWFWVCPNGGDKCMYKHALPPGFVLKTKEQR
AAEKALMDKSPLKTLTLEDFLESERHKLTGNLTPVTPETFAKWKKERLDKKAAEEQARKAKENTGRALFESGKWR
DEDESDDGDEDDTWNLTKLRNETQAALLQKEEDRLLAGGQDDEGQDAD*
Coding >Ophcf2|05810
ATGCCTCCGAAAAAGGCGGAGAAGGCGGCCGGCGGGAAGAAGCCGTCGGCCTCCAAGATGGTGGAGGATCGAACA
TTCGGCATGAAGAATAAAAAAGGCGCCGTCGCCCAGAAACAGATTGCCCAGATGGCGACGAACCTCAAGGCCGGA
GGAAGCGCTGAAGAGAAACGCAAGGCGGCCGAGAAGGCGGCGAGAGAGCGTGAGAAGAAAGCGGCCGAGGACGCC
AGGAAAGAGGCCGCAGCTCTACTAAACAGGCCGGCACAGATTCAGAAAGTGCCGTTCGGCGTGGACCCCAAGACG
GTCGTGTGCATCTTTTACAAAAAGGGCGACTGCGAAAAGGGAAAAAAGTGCAAGTTCTCGCACGACCTGTCCATC
GAGCGCAAAACGGAAAAGAAGAATCTGTATTCGGACACGAGAAAAGAGGACGAGGAAGAAGCGGAAGAGACCAAG
AAGCAAGAGACTTCGGCCGACTGGGACGAGGAGCAGCTGCGCAAGGTGGTGCTGTCGAAAAAGGGCAACCAACGA
ACGACGACGGAAAAGGTCTGCAAGTTCTTCATCTCGGCCATCGAGGACGGCAAATACGGCTGGTTCTGGGTGTGT
CCCAATGGGGGAGACAAGTGCATGTATAAGCACGCCTTGCCACCTGGGTTTGTTCTCAAGACCAAGGAGCAGCGG
GCGGCAGAAAAGGCGCTCATGGACAAGTCGCCGCTGAAGACGCTGACACTAGAGGACTTTTTGGAATCCGAGCGA
CACAAGCTTACGGGCAACCTGACGCCCGTGACGCCGGAGACCTTTGCCAAGTGGAAAAAGGAACGGCTGGACAAG
AAGGCTGCAGAAGAGCAGGCGCGCAAGGCCAAGGAGAATACGGGTCGTGCCCTGTTCGAGAGCGGCAAGTGGCGC
GACGAGGACGAGTCGGACGACGGCGACGAAGACGACACTTGGAACTTGACGAAGCTGCGTAACGAGACTCAGGCG
GCGCTTCTTCAGAAGGAGGAGGATCGACTGCTGGCGGGCGGACAAGACGACGAGGGGCAAGACGCAGACTGA
Transcript >Ophcf2|05810
ATGCCTCCGAAAAAGGCGGAGAAGGCGGCCGGCGGGAAGAAGCCGTCGGCCTCCAAGATGGTGGAGGATCGAACA
TTCGGCATGAAGAATAAAAAAGGCGCCGTCGCCCAGAAACAGATTGCCCAGATGGCGACGAACCTCAAGGCCGGA
GGAAGCGCTGAAGAGAAACGCAAGGCGGCCGAGAAGGCGGCGAGAGAGCGTGAGAAGAAAGCGGCCGAGGACGCC
AGGAAAGAGGCCGCAGCTCTACTAAACAGGCCGGCACAGATTCAGAAAGTGCCGTTCGGCGTGGACCCCAAGACG
GTCGTGTGCATCTTTTACAAAAAGGGCGACTGCGAAAAGGGAAAAAAGTGCAAGTTCTCGCACGACCTGTCCATC
GAGCGCAAAACGGAAAAGAAGAATCTGTATTCGGACACGAGAAAAGAGGACGAGGAAGAAGCGGAAGAGACCAAG
AAGCAAGAGACTTCGGCCGACTGGGACGAGGAGCAGCTGCGCAAGGTGGTGCTGTCGAAAAAGGGCAACCAACGA
ACGACGACGGAAAAGGTCTGCAAGTTCTTCATCTCGGCCATCGAGGACGGCAAATACGGCTGGTTCTGGGTGTGT
CCCAATGGGGGAGACAAGTGCATGTATAAGCACGCCTTGCCACCTGGGTTTGTTCTCAAGACCAAGGAGCAGCGG
GCGGCAGAAAAGGCGCTCATGGACAAGTCGCCGCTGAAGACGCTGACACTAGAGGACTTTTTGGAATCCGAGCGA
CACAAGCTTACGGGCAACCTGACGCCCGTGACGCCGGAGACCTTTGCCAAGTGGAAAAAGGAACGGCTGGACAAG
AAGGCTGCAGAAGAGCAGGCGCGCAAGGCCAAGGAGAATACGGGTCGTGCCCTGTTCGAGAGCGGCAAGTGGCGC
GACGAGGACGAGTCGGACGACGGCGACGAAGACGACACTTGGAACTTGACGAAGCTGCGTAACGAGACTCAGGCG
GCGCTTCTTCAGAAGGAGGAGGATCGACTGCTGGCGGGCGGACAAGACGACGAGGGGCAAGACGCAGACTGA
Gene >Ophcf2|05810
ATGCCTCCGAAAAAGGCGGAGAAGGCGGCCGGCGGGAAGAAGCCGTCGGCCTCCAAGATGGTGGAGGATCGAACA
TTCGGCATGAAGAATAAAAAAGGCGCCGTCGCCCAGAAACAGATTGCCCAGATGGCGACGAACCTCAAGGCCGGA
GGAAGCGCTGAAGAGAAACGCAAGGCGGCCGAGAAGGCGGCGAGAGAGCGTGAGAAGAAAGCGGCCGAGGACGCC
AGGAAAGAGGCCGCAGCTCTACTAAACAGGCCGGCACAGATTCAGAAAGTGCCGTTCGGCGTGGACCCCAAGACG
GTCGTGTGCATCTTTTACAAAAAGGGCGACTGCGAAAAGGGAAAAAAGTGCAAGTTCTCGCACGACCTGTCCATC
GAGCGCAAAACGGAAAAGAAGAATCTGTATTCGGACACGAGAAAAGAGGACGAGGAAGAAGCGGAAGAGACCAAG
AAGCAAGAGACTTCGGCCGACTGGGACGAGGAGCAGCTGCGCAAGGTGGTGCTGTCGAAAAAGGGCAACCAACGA
ACGACGACGGAAAAGGTCTGCAAGTTCTTCATCTCGGCCATCGAGGACGGCAAATACGGCTGGTTCTGGGTGTGT
CCCAATGGGGGAGACAAGTGCATGTATAAGCACGCCTTGCCACCTGGGTATGTTGGCTGGCGTTTTCCGAGCTCA
AGGTGGCGACTGACAAGACGGACAGGTTTGTTCTCAAGACCAAGGAGCAGCGGGCGGCAGAAAAGGCGCTCATGG
ACAAGTCGCCGCTGAAGACGCTGACACTAGAGGACTTTTTGGAATCCGAGCGACACAAGCTTACGGGCAACCTGA
CGCCCGTGACGCCGGAGACCTTTGCCAAGTGGAAAAAGGAACGGCTGGACAAGAAGGCTGCAGAAGAGCAGGCGC
GCAAGGCCAAGGAGAATACGGGTCGTGCCCTGTTCGAGAGCGGCAAGTGGCGCGACGAGGACGAGTCGGACGACG
GCGACGAAGACGACACTTGGAACTTGACGAAGCTGCGTAACGAGACTCAGGCGGCGCTTCTTCAGAAGGAGGAGG
ATCGACTGCTGGCGGGCGGACAAGACGACGAGGGGCAAGACGCAGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail