Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05806
Gene name
Locationscaffold_06:2298330..2302139
Strand-
Gene length (bp)3809
Transcript length (bp)3600
Coding sequence length (bp)3600
Protein length (aa) 1200

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11915 DUF3433 Protein of unknown function (DUF3433) 2.0E-21 51 135
PF11915 DUF3433 Protein of unknown function (DUF3433) 1.5E-15 647 733

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.5

Transmembrane Domains

Domain # Start End Length
1 5 24 19
2 46 68 22
3 117 139 22
4 499 521 22
5 620 637 17
6 647 664 17
7 710 732 22
8 1078 1097 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05806
MGAPSLITFAITSFFLAAMIEILAQRSRANGGLALSPSIREIPRPAVLASKYVPVVVATVYGVVWAWVDQDVKRM
QPWFELSRPGGARAGESLFLSYPHDFIVFVPWEAAKRRHWSVLLSSTMTIIILFLLTPLQPTITGIDPVKHTEPV
NIATRSLISGPLGLTGDNFLTEALMISKFSQPFPPFITPEYALLPFYVDGEVVRRSRDANVTTTTTMFTTELSCR
QPELLTGSGSSAGQDGRDGPVMLSFQGNSSSYNISDGHGCVINVESGTDNQWPYDVSYTHDVPWPGHLWTPDPRF
DKPDCSSNSGHRPLALVWEKLISNDSKETHRNMTARLCDINYYQQEMQVTITAGDSTIHQDSLRPVSPRQPMANF
SADHFEEVIQRFVVALYNSNTEDVTAKAVTQVLSEPIDGLAPRNSRCGSIRCQVNGVVKFVFTGQDLSVADFSHP
DKLVHEFSRARNFLFSLAVHHSIANRTDDANGYTASAAFPMTGIVVSRVMSALVEALFILSAISALVLLWICKKS
PCRLESNPNSISRLCRLCHDSRGAIRPFEGLDMADEKELKRALGKERFRLCRRGSRLCLERIAGADSLSAADETT
RVEASADKDRRPFEMTRKAGVVFLLVLLGAIIAIVCTKVTEVRQRERYIPTIYGTMAYSFWLILNRHLCTLQPFR
DLCAGNAPPSRSIATTYSAIPPSLTLWRAFKARHWVLTMLCSVALLGRLLGISLGTLFNENRGIVAYPRRFEPLT
ASGFNDRSLVDFHRLNQGHTPIYDVYNLYANVTTGAPLPPWVSIDYFFQPHKLGQDGPVSSDATYQLTTRGFGAN
ANCTSVFQLPAPQPEDNSTCSTAMDVAANKLQSLTNSASPGRSHCSLEMLAPSALNDTGVCPFDFVLSWARASLS
CGVWAVGKRAEPSATAIHCKPFFETAMFNVSVDPAGNVYSYNRTGETESTLAYPDFARHARLLLRYALPFPRSQD
EAMAGQGNNWHEDQHAADWISLLIAESKGSRDFIDPQTPPPDTFELIPIVQQLYRKGFAIVLGRHHNLFNQADTT
TTQPASISPSTGFKLVTETRIFFDETSLIITLTILSIDILVAIVLYTRPSLRVLPRMPTSIASTMAYVATSQLVH
SSQRPLESDSFSFGRYVGLDGKSHLGIDRASRVTLVKPSSDVKGSLFSRVRGFRRPRRSDMPSEQGPEYTALNV*
Coding >Ophcf2|05806
ATGGGCGCCCCCTCCCTCATAACCTTCGCCATAACCTCCTTCTTCCTAGCCGCCATGATCGAAATCCTCGCCCAA
CGAAGTAGAGCAAACGGAGGTCTCGCCCTCTCGCCCTCCATCCGGGAGATCCCGCGGCCGGCTGTGCTGGCGTCC
AAGTACGTGCCCGTCGTGGTGGCGACGGTGTATGGTGTTGTTTGGGCTTGGGTCGATCAGGATGTTAAGCGGATG
CAGCCCTGGTTTGAGCTTTCGAGGCCCGGGGGGGCGAGGGCTGGGGAGTCGTTGTTTCTCAGCTATCCGCATGAC
TTTATCGTCTTCGTGCCGTGGGAGGCGGCCAAGAGGAGACACTGGAGCGTCCTCCTCTCCAGCACAATGACCATC
ATCATCCTCTTCCTCCTCACCCCCCTACAACCAACCATCACAGGCATCGACCCCGTCAAGCACACCGAACCAGTC
AACATAGCAACCCGATCCCTCATCAGCGGACCCCTCGGTCTCACGGGCGACAACTTCCTAACCGAAGCCTTGATG
ATCAGCAAGTTTTCCCAGCCGTTCCCACCCTTCATCACTCCGGAATACGCCCTCCTCCCGTTCTACGTCGACGGC
GAGGTTGTGCGGAGGAGCAGAGATGCGAACGTGACGACGACGACGACAATGTTCACCACGGAACTTAGCTGTCGA
CAGCCGGAACTCTTGACGGGGTCCGGCTCTTCGGCTGGTCAAGACGGCAGAGATGGACCCGTGATGCTCTCATTC
CAGGGCAACAGTAGCAGCTACAACATCTCGGACGGACACGGCTGTGTCATCAATGTCGAGTCCGGGACGGACAAC
CAGTGGCCCTACGACGTCTCCTACACGCACGACGTCCCCTGGCCAGGCCATCTCTGGACCCCGGATCCCAGATTC
GACAAGCCAGACTGCAGTTCCAACTCGGGTCACCGGCCCCTGGCCCTCGTCTGGGAGAAGCTCATCTCCAACGAC
TCCAAAGAGACGCACCGGAACATGACAGCCCGTCTCTGCGATATAAACTACTACCAGCAGGAAATGCAAGTCACA
ATCACCGCAGGAGACTCTACAATCCATCAAGACTCCTTACGACCCGTCTCTCCTCGACAGCCAATGGCCAACTTC
TCAGCCGACCACTTCGAAGAAGTCATCCAGCGCTTCGTCGTAGCTCTCTACAACTCCAACACCGAAGACGTGACG
GCAAAAGCAGTAACGCAAGTCCTCTCCGAACCCATCGACGGACTTGCACCCAGAAACTCGCGCTGCGGTTCGATA
CGATGCCAAGTCAACGGTGTTGTCAAGTTTGTCTTTACGGGACAGGATCTCTCCGTCGCCGACTTTTCTCATCCG
GACAAACTCGTACATGAATTCAGTCGGGCTCGCAACTTTCTCTTCTCCCTTGCTGTTCACCACTCCATCGCCAAC
CGGACCGATGACGCCAACGGATACACCGCATCCGCCGCCTTTCCCATGACGGGGATAGTGGTCAGCAGAGTCATG
TCCGCCCTGGTAGAAGCCCTCTTCATCCTCAGCGCCATATCAGCTCTTGTTCTTCTCTGGATCTGCAAGAAATCT
CCCTGTCGTCTAGAGTCCAACCCCAACTCCATCTCTCGTCTCTGCCGCCTCTGTCACGACTCTCGAGGGGCCATC
CGTCCGTTCGAAGGACTGGATATGGCGGATGAGAAGGAGCTGAAGCGTGCATTGGGAAAGGAACGCTTTCGGCTT
TGTCGGAGGGGGAGTCGGTTGTGTCTTGAGAGGATCGCGGGGGCGGACAGCTTGAGTGCTGCGGATGAGACGACT
CGAGTTGAAGCTTCGGCTGATAAAGATCGACGGCCGTTTGAGATGACTCGCAAGGCGGGCGTCGTCTTTCTCCTC
GTCTTGCTGGGCGCCATCATTGCCATCGTCTGTACCAAGGTGACTGAAGTTCGCCAACGAGAACGCTACATCCCG
ACCATCTACGGAACCATGGCCTACTCCTTCTGGCTCATCCTCAACAGACACCTCTGCACCCTCCAACCCTTCAGA
GACCTGTGCGCCGGAAACGCACCTCCGAGCCGGAGCATAGCAACGACCTACTCGGCCATTCCACCGTCCTTGACG
CTCTGGAGAGCCTTCAAAGCTCGACACTGGGTTCTCACAATGCTGTGTTCTGTTGCCTTGCTGGGCAGGCTTCTG
GGCATCAGCCTGGGCACGCTCTTCAACGAGAATAGGGGCATCGTTGCTTATCCTCGACGCTTCGAGCCTCTGACT
GCGTCCGGATTCAACGACCGGTCACTCGTAGACTTCCACCGCCTCAACCAGGGTCATACCCCCATCTACGACGTC
TATAATCTATATGCCAACGTCACCACCGGTGCACCGCTTCCGCCCTGGGTATCCATCGACTACTTCTTCCAACCG
CATAAACTCGGACAAGATGGCCCCGTCTCTTCAGACGCAACCTATCAACTTACAACGCGTGGCTTCGGCGCAAAC
GCCAACTGCACGTCCGTCTTCCAGCTCCCAGCACCGCAACCCGAGGACAACTCGACCTGCTCGACTGCCATGGAC
GTGGCCGCCAATAAACTCCAATCGCTCACCAACTCGGCGAGTCCAGGTCGATCACACTGCTCGCTAGAGATGCTC
GCCCCCTCTGCACTCAATGACACTGGCGTCTGTCCATTCGACTTTGTCCTCAGCTGGGCCAGAGCCAGCCTCTCT
TGCGGAGTATGGGCGGTAGGCAAACGAGCCGAGCCGAGCGCCACAGCCATCCACTGCAAACCGTTCTTCGAGACG
GCCATGTTCAACGTCTCTGTCGATCCAGCAGGAAACGTCTACTCGTATAACAGGACCGGAGAGACGGAGTCAACT
CTAGCTTATCCCGACTTTGCTCGACACGCCCGGCTGTTGTTGAGATATGCCCTACCCTTCCCTCGGAGCCAAGAC
GAGGCCATGGCGGGACAAGGAAACAACTGGCATGAAGATCAGCACGCTGCCGACTGGATATCTCTATTGATAGCC
GAGTCGAAAGGGTCGCGAGACTTTATCGATCCGCAAACGCCGCCCCCGGATACATTCGAACTCATCCCCATTGTC
CAACAGCTGTATCGCAAAGGTTTCGCAATCGTACTCGGACGTCATCACAATCTCTTCAACCAAGCTGATACCACA
ACAACACAACCCGCCAGCATCTCACCATCAACAGGCTTCAAACTCGTCACCGAAACACGCATCTTCTTCGACGAA
ACCTCCCTAATCATCACCCTCACCATCCTATCCATCGACATCCTCGTCGCCATCGTCCTCTACACCAGACCGTCT
CTACGCGTCCTCCCCCGAATGCCAACCTCAATCGCTTCCACCATGGCGTACGTGGCCACCAGTCAACTCGTCCAT
TCGAGCCAACGCCCGTTGGAGAGCGACAGCTTCAGCTTCGGGCGGTATGTAGGGCTTGATGGGAAGTCGCATCTT
GGCATCGACCGGGCGAGCCGAGTGACCCTTGTCAAACCGTCGTCAGATGTCAAGGGGAGTCTGTTCAGTAGAGTA
CGGGGTTTCAGGCGGCCGAGGAGAAGTGACATGCCGAGCGAGCAAGGCCCAGAGTACACGGCCTTGAATGTTTAA
Transcript >Ophcf2|05806
ATGGGCGCCCCCTCCCTCATAACCTTCGCCATAACCTCCTTCTTCCTAGCCGCCATGATCGAAATCCTCGCCCAA
CGAAGTAGAGCAAACGGAGGTCTCGCCCTCTCGCCCTCCATCCGGGAGATCCCGCGGCCGGCTGTGCTGGCGTCC
AAGTACGTGCCCGTCGTGGTGGCGACGGTGTATGGTGTTGTTTGGGCTTGGGTCGATCAGGATGTTAAGCGGATG
CAGCCCTGGTTTGAGCTTTCGAGGCCCGGGGGGGCGAGGGCTGGGGAGTCGTTGTTTCTCAGCTATCCGCATGAC
TTTATCGTCTTCGTGCCGTGGGAGGCGGCCAAGAGGAGACACTGGAGCGTCCTCCTCTCCAGCACAATGACCATC
ATCATCCTCTTCCTCCTCACCCCCCTACAACCAACCATCACAGGCATCGACCCCGTCAAGCACACCGAACCAGTC
AACATAGCAACCCGATCCCTCATCAGCGGACCCCTCGGTCTCACGGGCGACAACTTCCTAACCGAAGCCTTGATG
ATCAGCAAGTTTTCCCAGCCGTTCCCACCCTTCATCACTCCGGAATACGCCCTCCTCCCGTTCTACGTCGACGGC
GAGGTTGTGCGGAGGAGCAGAGATGCGAACGTGACGACGACGACGACAATGTTCACCACGGAACTTAGCTGTCGA
CAGCCGGAACTCTTGACGGGGTCCGGCTCTTCGGCTGGTCAAGACGGCAGAGATGGACCCGTGATGCTCTCATTC
CAGGGCAACAGTAGCAGCTACAACATCTCGGACGGACACGGCTGTGTCATCAATGTCGAGTCCGGGACGGACAAC
CAGTGGCCCTACGACGTCTCCTACACGCACGACGTCCCCTGGCCAGGCCATCTCTGGACCCCGGATCCCAGATTC
GACAAGCCAGACTGCAGTTCCAACTCGGGTCACCGGCCCCTGGCCCTCGTCTGGGAGAAGCTCATCTCCAACGAC
TCCAAAGAGACGCACCGGAACATGACAGCCCGTCTCTGCGATATAAACTACTACCAGCAGGAAATGCAAGTCACA
ATCACCGCAGGAGACTCTACAATCCATCAAGACTCCTTACGACCCGTCTCTCCTCGACAGCCAATGGCCAACTTC
TCAGCCGACCACTTCGAAGAAGTCATCCAGCGCTTCGTCGTAGCTCTCTACAACTCCAACACCGAAGACGTGACG
GCAAAAGCAGTAACGCAAGTCCTCTCCGAACCCATCGACGGACTTGCACCCAGAAACTCGCGCTGCGGTTCGATA
CGATGCCAAGTCAACGGTGTTGTCAAGTTTGTCTTTACGGGACAGGATCTCTCCGTCGCCGACTTTTCTCATCCG
GACAAACTCGTACATGAATTCAGTCGGGCTCGCAACTTTCTCTTCTCCCTTGCTGTTCACCACTCCATCGCCAAC
CGGACCGATGACGCCAACGGATACACCGCATCCGCCGCCTTTCCCATGACGGGGATAGTGGTCAGCAGAGTCATG
TCCGCCCTGGTAGAAGCCCTCTTCATCCTCAGCGCCATATCAGCTCTTGTTCTTCTCTGGATCTGCAAGAAATCT
CCCTGTCGTCTAGAGTCCAACCCCAACTCCATCTCTCGTCTCTGCCGCCTCTGTCACGACTCTCGAGGGGCCATC
CGTCCGTTCGAAGGACTGGATATGGCGGATGAGAAGGAGCTGAAGCGTGCATTGGGAAAGGAACGCTTTCGGCTT
TGTCGGAGGGGGAGTCGGTTGTGTCTTGAGAGGATCGCGGGGGCGGACAGCTTGAGTGCTGCGGATGAGACGACT
CGAGTTGAAGCTTCGGCTGATAAAGATCGACGGCCGTTTGAGATGACTCGCAAGGCGGGCGTCGTCTTTCTCCTC
GTCTTGCTGGGCGCCATCATTGCCATCGTCTGTACCAAGGTGACTGAAGTTCGCCAACGAGAACGCTACATCCCG
ACCATCTACGGAACCATGGCCTACTCCTTCTGGCTCATCCTCAACAGACACCTCTGCACCCTCCAACCCTTCAGA
GACCTGTGCGCCGGAAACGCACCTCCGAGCCGGAGCATAGCAACGACCTACTCGGCCATTCCACCGTCCTTGACG
CTCTGGAGAGCCTTCAAAGCTCGACACTGGGTTCTCACAATGCTGTGTTCTGTTGCCTTGCTGGGCAGGCTTCTG
GGCATCAGCCTGGGCACGCTCTTCAACGAGAATAGGGGCATCGTTGCTTATCCTCGACGCTTCGAGCCTCTGACT
GCGTCCGGATTCAACGACCGGTCACTCGTAGACTTCCACCGCCTCAACCAGGGTCATACCCCCATCTACGACGTC
TATAATCTATATGCCAACGTCACCACCGGTGCACCGCTTCCGCCCTGGGTATCCATCGACTACTTCTTCCAACCG
CATAAACTCGGACAAGATGGCCCCGTCTCTTCAGACGCAACCTATCAACTTACAACGCGTGGCTTCGGCGCAAAC
GCCAACTGCACGTCCGTCTTCCAGCTCCCAGCACCGCAACCCGAGGACAACTCGACCTGCTCGACTGCCATGGAC
GTGGCCGCCAATAAACTCCAATCGCTCACCAACTCGGCGAGTCCAGGTCGATCACACTGCTCGCTAGAGATGCTC
GCCCCCTCTGCACTCAATGACACTGGCGTCTGTCCATTCGACTTTGTCCTCAGCTGGGCCAGAGCCAGCCTCTCT
TGCGGAGTATGGGCGGTAGGCAAACGAGCCGAGCCGAGCGCCACAGCCATCCACTGCAAACCGTTCTTCGAGACG
GCCATGTTCAACGTCTCTGTCGATCCAGCAGGAAACGTCTACTCGTATAACAGGACCGGAGAGACGGAGTCAACT
CTAGCTTATCCCGACTTTGCTCGACACGCCCGGCTGTTGTTGAGATATGCCCTACCCTTCCCTCGGAGCCAAGAC
GAGGCCATGGCGGGACAAGGAAACAACTGGCATGAAGATCAGCACGCTGCCGACTGGATATCTCTATTGATAGCC
GAGTCGAAAGGGTCGCGAGACTTTATCGATCCGCAAACGCCGCCCCCGGATACATTCGAACTCATCCCCATTGTC
CAACAGCTGTATCGCAAAGGTTTCGCAATCGTACTCGGACGTCATCACAATCTCTTCAACCAAGCTGATACCACA
ACAACACAACCCGCCAGCATCTCACCATCAACAGGCTTCAAACTCGTCACCGAAACACGCATCTTCTTCGACGAA
ACCTCCCTAATCATCACCCTCACCATCCTATCCATCGACATCCTCGTCGCCATCGTCCTCTACACCAGACCGTCT
CTACGCGTCCTCCCCCGAATGCCAACCTCAATCGCTTCCACCATGGCGTACGTGGCCACCAGTCAACTCGTCCAT
TCGAGCCAACGCCCGTTGGAGAGCGACAGCTTCAGCTTCGGGCGGTATGTAGGGCTTGATGGGAAGTCGCATCTT
GGCATCGACCGGGCGAGCCGAGTGACCCTTGTCAAACCGTCGTCAGATGTCAAGGGGAGTCTGTTCAGTAGAGTA
CGGGGTTTCAGGCGGCCGAGGAGAAGTGACATGCCGAGCGAGCAAGGCCCAGAGTACACGGCCTTGAATGTTTAA
Gene >Ophcf2|05806
ATGGGCGCCCCCTCCCTCATAACCTTCGCCATAACCTCCTTCTTCCTAGCCGCCATGATCGAAATCCTCGCCCAA
CGAAGTAGAGCAAACGGAGGTCTCGCCCTCTCGCCCTCCATCCGGGAGATCCCGCGGCCGGCTGTGCTGGCGTCC
AAGTACGTGCCCGTCGTGGTGGCGACGGTGTATGGTGTTGTTTGGGCTTGGGTCGATCAGGATGTTAAGCGGATG
CAGCCCTGGTTTGAGCTTTCGAGGCCCGGGGGGGCGAGGGCTGGGGAGTCGTTGTTTCTCAGCTATCCGCATGAC
TTTATCGTCTTCGTGCCGTGGGAGGCGGCCAAGAGGAGGTGCGTGATTTTCTTCGATACGGTTGAGACGGTTGCT
GTTCAGTTGCCGTCAGTTGCTGACATCCACTACTCCTCAGACACTGGAGCGTCCTCCTCTCCAGCACAATGACCA
TCATCATCCTCTTCCTCCTCACCCCCCTACAACCAACCATCACAGGCATCGACCCCGTCAAGCACACCGAACCAG
TCAACATAGCAACCCGATCCCTCATCAGCGGACCCCTCGGTCTCACGGGCGACAACTTCCTAACCGAAGCCTTGA
TGATCAGCAAGTTTTCCCAGCCGTTCCCACCCTTCATCACTCCGGAATACGCCCTCCTCCCGTTCTACGTCGACG
GCGAGGTTGTGCGGAGGAGCAGAGATGCGAACGTGACGACGACGACGACAATGTTCACCACGGAACTTAGCTGTC
GACAGCCGGAACTCTTGACGGGGTCCGGCTCTTCGGCTGGTCAAGACGGCAGAGATGGACCCGTGATGCTCTCAT
TCCAGGGCAACAGTAGCAGCTACAACATCTCGGACGGACACGGCTGTGTCATCAATGTCGAGTCCGGGACGGACA
ACCAGTGGCCCTACGACGTCTCCTACACGCACGACGTCCCCTGGCCAGGCCATCTCTGGACCCCGGATCCCAGAT
TCGACAAGCCAGACTGCAGTTCCAACTCGGGTCACCGGCCCCTGGCCCTCGTCTGGGAGAAGCTCATCTCCAACG
ACTCCAAAGAGACGCACCGGAACATGACAGCCCGTCTCTGCGATATAAACTACTACCAGCAGGAAATGCAAGTCA
CAATCACCGCAGGAGACTCTACAATCCATCAAGACTCCTTACGACCCGTCTCTCCTCGACAGCCAATGGCCAACT
TCTCAGCCGACCACTTCGAAGAAGTCATCCAGCGCTTCGTCGTAGCTCTCTACAACTCCAACACCGAAGACGTGA
CGGCAAAAGCAGTAACGCAAGTCCTCTCCGAACCCATCGACGGACTTGCACCCAGAAACTCGCGCTGCGGTTCGA
TACGATGCCAAGTCAACGGTGTTGTCAAGTTTGTCTTTACGGGACAGGATCTCTCCGTCGCCGACTTTTCTCATC
CGGACAAACTCGTACATGAATTCAGTCGGGCTCGCAACTTTCTCTTCTCCCTTGCTGTTCACCACTCCATCGCCA
ACCGGACCGATGACGCCAACGGATACACCGCATCCGCCGCCTTTCCCATGACGGGGATAGTGGTCAGCAGAGTCA
TGTCCGCCCTGGTAGAAGCCCTCTTCATCCTCAGCGCCATATCAGCTCTTGTTCTTCTCTGGATCTGCAAGAAAT
CTCCCTGTCGTCTAGAGTCCAACCCCAACTCCATCTCTCGTCTCTGCCGCCTCTGTCACGACTCTCGAGGGGCCA
TCCGTCCGTTCGAAGGACTGGATATGGCGGATGAGAAGGAGCTGAAGCGTGCATTGGGAAAGGAACGCTTTCGGC
TTTGTCGGAGGGGGAGTCGGTTGTGTCTTGAGAGGATCGCGGGGGCGGACAGCTTGAGTGCTGCGGATGAGACGA
CTCGAGTTGAAGCTTCGGCTGATAAAGATCGACGGCCGTTTGAGATGACTCGCAAGGCGGGCGTCGTCTTTCTCC
TCGTCTTGCTGGGCGCCATCATTGCCATCGTCTGTACCAAGGTGACTGAAGTTCGCCAACGAGGTAAGAAGAGCG
AAGCGTTCTTGACAGTTTGTCAACCTGCTGACAACCAACCAACCAACCAACCAACCAACCAACCAACCAACCCAG
GGATACAACGCCCGTCCTCAAACAACGAAATCACCCGTATCCTAGAACGCTACATCCCGACCATCTACGGAACCA
TGGCCTACTCCTTCTGGCTCATCCTCAACAGACACCTCTGCACCCTCCAACCCTTCAGAGACCTGTGCGCCGGAA
ACGCACCTCCGAGCCGGAGCATAGCAACGACCTACTCGGCCATTCCACCGTCCTTGACGCTCTGGAGAGCCTTCA
AAGCTCGACACTGGGTTCTCACAATGCTGTGTTCTGTTGCCTTGCTGGGCAGGCTTCTGGGCATCAGCCTGGGCA
CGCTCTTCAACGAGAATAGGGGCATCGTTGCTTATCCTCGACGCTTCGAGCCTCTGACTGCGTCCGGATTCAACG
ACCGGTCACTCGTAGACTTCCACCGCCTCAACCAGGGTCATACCCCCATCTACGACGTCTATAATCTATATGCCA
ACGTCACCACCGGTGCACCGCTTCCGCCCTGGGTATCCATCGACTACTTCTTCCAACCGCATAAACTCGGACAAG
ATGGCCCCGTCTCTTCAGACGCAACCTATCAACTTACAACGCGTGGCTTCGGCGCAAACGCCAACTGCACGTCCG
TCTTCCAGCTCCCAGCACCGCAACCCGAGGACAACTCGACCTGCTCGACTGCCATGGACGTGGCCGCCAATAAAC
TCCAATCGCTCACCAACTCGGCGAGTCCAGGTCGATCACACTGCTCGCTAGAGATGCTCGCCCCCTCTGCACTCA
ATGACACTGGCGTCTGTCCATTCGACTTTGTCCTCAGCTGGGCCAGAGCCAGCCTCTCTTGCGGAGTATGGGCGG
TAGGCAAACGAGCCGAGCCGAGCGCCACAGCCATCCACTGCAAACCGTTCTTCGAGACGGCCATGTTCAACGTCT
CTGTCGATCCAGCAGGAAACGTCTACTCGTATAACAGGACCGGAGAGACGGAGTCAACTCTAGCTTATCCCGACT
TTGCTCGACACGCCCGGCTGTTGTTGAGATATGCCCTACCCTTCCCTCGGAGCCAAGACGAGGCCATGGCGGGAC
AAGGAAACAACTGGCATGAAGATCAGCACGCTGCCGACTGGATATCTCTATTGATAGCCGAGTCGAAAGGGTCGC
GAGACTTTATCGATCCGCAAACGCCGCCCCCGGATACATTCGAACTCATCCCCATTGTCCAACAGCTGTATCGCA
AAGGTTTCGCAATCGTACTCGGACGTCATCACAATCTCTTCAACCAAGCTGATACCACAACAACACAACCCGCCA
GCATCTCACCATCAACAGGCTTCAAACTCGTCACCGAAACACGCATCTTCTTCGACGAAACCTCCCTAATCATCA
CCCTCACCATCCTATCCATCGACATCCTCGTCGCCATCGTCCTCTACACCAGACCGTCTCTACGCGTCCTCCCCC
GAATGCCAACCTCAATCGCTTCCACCATGGCGTACGTGGCCACCAGTCAACTCGTCCATTCGAGCCAACGCCCGT
TGGAGAGCGACAGCTTCAGCTTCGGGCGGTATGTAGGGCTTGATGGGAAGTCGCATCTTGGCATCGACCGGGCGA
GCCGAGTGACCCTTGTCAAACCGTCGTCAGATGTCAAGGGGAGTCTGTTCAGTAGAGTACGGGGTTTCAGGCGGC
CGAGGAGAAGTGACATGCCGAGCGAGCAAGGCCCAGAGTACACGGCCTTGAATGTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail