Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05798
Gene name
Locationscaffold_06:2280582..2282044
Strand-
Gene length (bp)1462
Transcript length (bp)1260
Coding sequence length (bp)1260
Protein length (aa) 420

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00026 Asp Eukaryotic aspartyl protease 1.3E-55 92 413
PF14543 TAXi_N Xylanase inhibitor N-terminal 2.3E-10 92 209

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05798
MKRFIPIFLLALSLTTAAAPGFWTAAPVITLRVEQRASYRRDFTADVEAARRKWGSMPGVQGVSLAESGGGLHDD
GVESMVVVRPLVHDQIYVADVEVGTPPQRVKMALDTGSSDVWVQSTDTRYRLNTAGPYPPRYNPNASSTARHIEK
AMWNIRYADESNAIGIVYRDTLRLGTLSIPNATIQSASTISSTFERETGFSGIMGLAKRLHNNIDPPEPNFLSLL
QAQLHKPIFTVDLRHNASSRFDFGHLDPTLASDQITWLPTNASNPHWSIQLDLLAWRTPKSVWIKHRFEAIIDTG
TSLMFLPDKLAARYWASVPGVDSASAPEGAYRFPCAAEPDLPDLLVKLPGTEHVVSVPGRYLNYGPTPLDPALCW
GGLQSAQQLGGGAILGDVFLKAVFVAFDIDGGRVGFANKALRDV*
Coding >Ophcf2|05798
ATGAAGAGGTTCATCCCCATCTTCCTCCTAGCCCTCAGCCTCACGACGGCAGCAGCCCCGGGCTTCTGGACGGCG
GCGCCCGTCATCACCCTTCGAGTCGAGCAGCGGGCGAGCTACCGCCGAGACTTCACGGCTGATGTCGAGGCGGCG
CGTCGGAAGTGGGGGTCCATGCCTGGAGTTCAGGGGGTTTCCCTCGCGGAGAGCGGCGGGGGGTTGCACGATGAT
GGGGTGGAGAGTATGGTCGTGGTCAGGCCTTTGGTTCATGATCAGATTTATGTTGCGGATGTGGAGGTTGGGACT
CCGCCTCAGAGAGTTAAGATGGCTCTCGATACGGGCTCTTCAGATGTCTGGGTTCAATCAACCGACACAAGATAC
CGTCTCAACACCGCAGGCCCCTACCCACCACGCTACAACCCCAACGCCTCATCAACAGCCCGTCACATCGAAAAA
GCCATGTGGAACATCCGCTACGCCGACGAGAGCAACGCAATAGGCATCGTCTACCGCGACACCCTCCGCCTGGGA
ACGCTCTCCATCCCCAACGCAACCATCCAATCCGCCTCGACGATATCCTCCACCTTCGAGCGAGAAACCGGCTTC
AGCGGGATAATGGGTCTAGCAAAACGACTACACAACAACATCGACCCTCCAGAACCAAACTTCCTCTCATTGCTA
CAAGCCCAACTCCACAAGCCCATCTTCACCGTCGACCTCCGACACAACGCATCCAGCAGATTCGACTTCGGCCAC
CTGGACCCGACCCTAGCCTCGGATCAAATCACCTGGCTTCCGACCAACGCCTCGAACCCCCACTGGTCAATCCAA
CTCGACCTCCTCGCCTGGCGAACCCCCAAAAGCGTCTGGATCAAACACCGCTTCGAAGCCATCATCGACACGGGA
ACCTCCCTCATGTTCCTCCCGGATAAGCTAGCAGCCCGATACTGGGCCTCCGTCCCGGGCGTCGACTCGGCCTCC
GCACCGGAGGGCGCCTACCGCTTCCCCTGCGCCGCAGAGCCCGACCTCCCAGACCTACTCGTCAAGCTTCCGGGC
ACCGAGCACGTCGTCAGCGTCCCCGGCCGCTATCTCAACTACGGGCCCACGCCCCTCGACCCGGCCCTCTGCTGG
GGCGGTCTGCAGAGTGCCCAGCAGCTGGGAGGGGGGGCCATCTTGGGGGATGTCTTTCTCAAGGCCGTGTTTGTC
GCCTTTGACATTGACGGTGGTCGTGTGGGTTTCGCCAATAAGGCGTTGCGCGATGTCTGA
Transcript >Ophcf2|05798
ATGAAGAGGTTCATCCCCATCTTCCTCCTAGCCCTCAGCCTCACGACGGCAGCAGCCCCGGGCTTCTGGACGGCG
GCGCCCGTCATCACCCTTCGAGTCGAGCAGCGGGCGAGCTACCGCCGAGACTTCACGGCTGATGTCGAGGCGGCG
CGTCGGAAGTGGGGGTCCATGCCTGGAGTTCAGGGGGTTTCCCTCGCGGAGAGCGGCGGGGGGTTGCACGATGAT
GGGGTGGAGAGTATGGTCGTGGTCAGGCCTTTGGTTCATGATCAGATTTATGTTGCGGATGTGGAGGTTGGGACT
CCGCCTCAGAGAGTTAAGATGGCTCTCGATACGGGCTCTTCAGATGTCTGGGTTCAATCAACCGACACAAGATAC
CGTCTCAACACCGCAGGCCCCTACCCACCACGCTACAACCCCAACGCCTCATCAACAGCCCGTCACATCGAAAAA
GCCATGTGGAACATCCGCTACGCCGACGAGAGCAACGCAATAGGCATCGTCTACCGCGACACCCTCCGCCTGGGA
ACGCTCTCCATCCCCAACGCAACCATCCAATCCGCCTCGACGATATCCTCCACCTTCGAGCGAGAAACCGGCTTC
AGCGGGATAATGGGTCTAGCAAAACGACTACACAACAACATCGACCCTCCAGAACCAAACTTCCTCTCATTGCTA
CAAGCCCAACTCCACAAGCCCATCTTCACCGTCGACCTCCGACACAACGCATCCAGCAGATTCGACTTCGGCCAC
CTGGACCCGACCCTAGCCTCGGATCAAATCACCTGGCTTCCGACCAACGCCTCGAACCCCCACTGGTCAATCCAA
CTCGACCTCCTCGCCTGGCGAACCCCCAAAAGCGTCTGGATCAAACACCGCTTCGAAGCCATCATCGACACGGGA
ACCTCCCTCATGTTCCTCCCGGATAAGCTAGCAGCCCGATACTGGGCCTCCGTCCCGGGCGTCGACTCGGCCTCC
GCACCGGAGGGCGCCTACCGCTTCCCCTGCGCCGCAGAGCCCGACCTCCCAGACCTACTCGTCAAGCTTCCGGGC
ACCGAGCACGTCGTCAGCGTCCCCGGCCGCTATCTCAACTACGGGCCCACGCCCCTCGACCCGGCCCTCTGCTGG
GGCGGTCTGCAGAGTGCCCAGCAGCTGGGAGGGGGGGCCATCTTGGGGGATGTCTTTCTCAAGGCCGTGTTTGTC
GCCTTTGACATTGACGGTGGTCGTGTGGGTTTCGCCAATAAGGCGTTGCGCGATGTCTGA
Gene >Ophcf2|05798
ATGAAGAGGTTCATCCCCATCTTCCTCCTAGCCCTCAGCCTCACGACGGCAGCAGCCCCGGGCTTCTGGACGGCG
GCGCCCGTCATCACCCTTCGAGTCGAGCAGCGGGCGAGCTACCGCCGAGACTTCACGGCTGATGTCGAGGCGGCG
CGTCGGAAGTGGGGGTCCATGCCTGGAGTTCAGGGGGTTTCCCTCGCGGAGAGCGGCGGGGGGTTGCACGGTTGG
TTTTTTTTTTTTTTTGGTTTGCGGTGGGTTTGTTGGTGATGGGGATCGGGGCTGACGGGTTGGTGTTCTAGATGA
TGGGGTGGAGAGTATGGTCGTGGTCAGGCCTTTGGTTCATGATCAGATTTATGTTGCGGATGTGGAGGTTGGGAC
TCCGCCTCAGAGAGTTAAGATGGCTCTCGATACGGGCTCTTCAGATGTGTTGGTTTCTCTCTTCCCGTTCCCCCC
TTTCTATGGACTATGTCGAAGCAACTAACCTCAAACACCAACAGCTGGGTTCAATCAACCGACACAAGATACCGT
CTCAACACCGCAGGCCCCTACCCACCACGCTACAACCCCAACGCCTCATCAACAGCCCGTCACATCGAAAAAGCC
ATGTGGAACATCCGCTACGGTAAACCCCCCCTTCCCCTTATCCCCTCTAACGACGATGAATCTAACAGCCCCAGC
CGACGAGAGCAACGCAATAGGCATCGTCTACCGCGACACCCTCCGCCTGGGAACGCTCTCCATCCCCAACGCAAC
CATCCAATCCGCCTCGACGATATCCTCCACCTTCGAGCGAGAAACCGGCTTCAGCGGGATAATGGGTCTAGCAAA
ACGACTACACAACAACATCGACCCTCCAGAACCAAACTTCCTCTCATTGCTACAAGCCCAACTCCACAAGCCCAT
CTTCACCGTCGACCTCCGACACAACGCATCCAGCAGATTCGACTTCGGCCACCTGGACCCGACCCTAGCCTCGGA
TCAAATCACCTGGCTTCCGACCAACGCCTCGAACCCCCACTGGTCAATCCAACTCGACCTCCTCGCCTGGCGAAC
CCCCAAAAGCGTCTGGATCAAACACCGCTTCGAAGCCATCATCGACACGGGAACCTCCCTCATGTTCCTCCCGGA
TAAGCTAGCAGCCCGATACTGGGCCTCCGTCCCGGGCGTCGACTCGGCCTCCGCACCGGAGGGCGCCTACCGCTT
CCCCTGCGCCGCAGAGCCCGACCTCCCAGACCTACTCGTCAAGCTTCCGGGCACCGAGCACGTCGTCAGCGTCCC
CGGCCGCTATCTCAACTACGGGCCCACGCCCCTCGACCCGGCCCTCTGCTGGGGCGGTCTGCAGAGTGCCCAGCA
GCTGGGAGGGGGGGCCATCTTGGGGGATGTCTTTCTCAAGGCCGTGTTTGTCGCCTTTGACATTGACGGTGGTCG
TGTGGGTTTCGCCAATAAGGCGTTGCGCGATGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail