Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05787
Gene name
Locationscaffold_06:2251181..2252009
Strand-
Gene length (bp)828
Transcript length (bp)780
Coding sequence length (bp)780
Protein length (aa) 260

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10197 Cir_N N-terminal domain of CBF1 interacting co-repressor CIR 3.5E-05 10 46

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3159 0.8418 0.0215 0.0258 0.1495 0.003 0.0195 0.0271 0.0101 0.0314

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1719
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|11
Ophiocordyceps australis map64 (Brazil) OphauB2|2671
Ophiocordyceps camponoti-floridani Ophcf2|05787 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3739
Ophiocordyceps kimflemingae Ophio5|6146
Ophiocordyceps subramaniannii Hirsu2|1549

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05787
MPLHLLGKKSWNVYNADNMARVRRDEAAAAIAASEAEKRAQQVESERRLAILRGEALPPSPPDHNDHGPAFAEVA
RRRPEGSRMGRLRKRQGEDDTDFELRVAREHGGQRRSPHRHTQSSAPIVDSAGHTDLFGSERIRSHAHKQRDPEG
ESRHHGEKHHDQSKPRRSNTPSGSTKKPWYTNADADMSPSARTSEVDPRRKQRQAKRLADEDPLTFMKEGARKVR
ELRGRRERERRERERRERDRELGKKDGRDGRGRR*
Coding >Ophcf2|05787
ATGCCGCTCCACCTCCTAGGCAAGAAATCATGGAACGTCTACAACGCCGACAACATGGCCCGCGTCCGACGCGAC
GAAGCCGCCGCCGCCATCGCAGCTTCAGAAGCAGAGAAGCGAGCGCAACAGGTTGAATCCGAGCGCCGGCTAGCT
ATCCTCCGTGGAGAGGCCCTCCCGCCATCACCCCCCGACCACAACGACCATGGCCCAGCTTTCGCAGAGGTCGCG
CGGCGCCGCCCCGAAGGCAGCAGGATGGGACGGCTCAGGAAACGGCAGGGGGAAGACGATACTGACTTTGAGTTA
CGGGTGGCTCGCGAACATGGGGGGCAGCGACGGAGTCCTCATCGCCATACGCAGTCGTCAGCGCCCATCGTCGAC
TCGGCCGGACACACAGACCTCTTCGGCAGCGAACGCATAAGAAGCCACGCGCACAAACAGCGAGACCCAGAGGGC
GAATCCCGCCACCACGGCGAGAAGCACCACGACCAATCCAAACCGCGCCGCTCCAACACGCCGTCCGGCTCCACG
AAGAAGCCATGGTACACCAACGCCGACGCCGACATGTCCCCTAGCGCACGAACGAGCGAGGTCGATCCGCGGAGG
AAGCAGAGGCAGGCCAAGAGGTTGGCGGATGAGGATCCGCTTACGTTTATGAAGGAGGGGGCCAGGAAGGTGCGG
GAGCTGAGGGGGAGGCGGGAGAGGGAAAGGCGGGAGAGGGAAAGGCGGGAGAGGGATCGGGAGCTGGGGAAGAAG
GATGGGAGGGACGGTCGAGGTCGCCGTTGA
Transcript >Ophcf2|05787
ATGCCGCTCCACCTCCTAGGCAAGAAATCATGGAACGTCTACAACGCCGACAACATGGCCCGCGTCCGACGCGAC
GAAGCCGCCGCCGCCATCGCAGCTTCAGAAGCAGAGAAGCGAGCGCAACAGGTTGAATCCGAGCGCCGGCTAGCT
ATCCTCCGTGGAGAGGCCCTCCCGCCATCACCCCCCGACCACAACGACCATGGCCCAGCTTTCGCAGAGGTCGCG
CGGCGCCGCCCCGAAGGCAGCAGGATGGGACGGCTCAGGAAACGGCAGGGGGAAGACGATACTGACTTTGAGTTA
CGGGTGGCTCGCGAACATGGGGGGCAGCGACGGAGTCCTCATCGCCATACGCAGTCGTCAGCGCCCATCGTCGAC
TCGGCCGGACACACAGACCTCTTCGGCAGCGAACGCATAAGAAGCCACGCGCACAAACAGCGAGACCCAGAGGGC
GAATCCCGCCACCACGGCGAGAAGCACCACGACCAATCCAAACCGCGCCGCTCCAACACGCCGTCCGGCTCCACG
AAGAAGCCATGGTACACCAACGCCGACGCCGACATGTCCCCTAGCGCACGAACGAGCGAGGTCGATCCGCGGAGG
AAGCAGAGGCAGGCCAAGAGGTTGGCGGATGAGGATCCGCTTACGTTTATGAAGGAGGGGGCCAGGAAGGTGCGG
GAGCTGAGGGGGAGGCGGGAGAGGGAAAGGCGGGAGAGGGAAAGGCGGGAGAGGGATCGGGAGCTGGGGAAGAAG
GATGGGAGGGACGGTCGAGGTCGCCGTTGA
Gene >Ophcf2|05787
ATGCCGCTGTTAGTGCCTTGTAGCTCACCCCAAACCTCACCCGCTGACGAGGATAGCCACCTCCTAGGCAAGAAA
TCATGGAACGTCTACAACGCCGACAACATGGCCCGCGTCCGACGCGACGAAGCCGCCGCCGCCATCGCAGCTTCA
GAAGCAGAGAAGCGAGCGCAACAGGTTGAATCCGAGCGCCGGCTAGCTATCCTCCGTGGAGAGGCCCTCCCGCCA
TCACCCCCCGACCACAACGACCATGGCCCAGCTTTCGCAGAGGTCGCGCGGCGCCGCCCCGAAGGCAGCAGGATG
GGACGGCTCAGGAAACGGCAGGGGGAAGACGATACTGACTTTGAGTTACGGGTGGCTCGCGAACATGGGGGGCAG
CGACGGAGTCCTCATCGCCATACGCAGTCGTCAGCGCCCATCGTCGACTCGGCCGGACACACAGACCTCTTCGGC
AGCGAACGCATAAGAAGCCACGCGCACAAACAGCGAGACCCAGAGGGCGAATCCCGCCACCACGGCGAGAAGCAC
CACGACCAATCCAAACCGCGCCGCTCCAACACGCCGTCCGGCTCCACGAAGAAGCCATGGTACACCAACGCCGAC
GCCGACATGTCCCCTAGCGCACGAACGAGCGAGGTCGATCCGCGGAGGAAGCAGAGGCAGGCCAAGAGGTTGGCG
GATGAGGATCCGCTTACGTTTATGAAGGAGGGGGCCAGGAAGGTGCGGGAGCTGAGGGGGAGGCGGGAGAGGGAA
AGGCGGGAGAGGGAAAGGCGGGAGAGGGATCGGGAGCTGGGGAAGAAGGATGGGAGGGACGGTCGAGGTCGCCGT
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail