Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05786
Gene name
Locationscaffold_06:2248659..2249281
Strand-
Gene length (bp)622
Transcript length (bp)555
Coding sequence length (bp)555
Protein length (aa) 185

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10241 KxDL Uncharacterized conserved protein 6.3E-32 87 171

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5512 0.6909 0.1768 0.1278 0.1202 0.0074 0.1286 0.0998 0.0414 0.0032

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3271
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|14
Ophiocordyceps australis map64 (Brazil) OphauB2|2674
Ophiocordyceps camponoti-floridani Ophcf2|05786 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1138
Ophiocordyceps kimflemingae Ophio5|3058
Ophiocordyceps subramaniannii Hirsu2|5966

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05786
MSGPYSTVPYSMPMPVPSKGNQYPAYSQYSISPPECDDSFSSASGVGSYSNSGFTAPSSGYMACSAADYDSTRSA
SGVDFQEYMQERFANSFNPIPLDRSMAVQAQTSGKLNAKHRELVELQKQAQARLAKTRERFNDGMRDAREVRGDL
EWTQKKVSSLQAKAARKHPKEHGKARARYPSPEC*
Coding >Ophcf2|05786
ATGTCCGGCCCCTACTCCACCGTCCCCTACTCCATGCCAATGCCCGTCCCCTCCAAGGGCAACCAGTATCCCGCC
TACAGCCAGTACTCCATCTCCCCCCCAGAGTGCGACGACTCCTTCAGCTCCGCCTCGGGCGTCGGCTCCTACAGC
AACAGCGGCTTCACTGCTCCCTCGTCCGGTTACATGGCCTGCTCTGCCGCCGACTATGACAGCACCCGCTCAGCC
AGCGGCGTCGACTTCCAGGAGTACATGCAGGAACGCTTCGCCAACTCCTTCAACCCCATTCCTCTAGACCGCAGC
ATGGCTGTCCAGGCTCAGACGTCCGGAAAGCTCAACGCCAAGCACCGCGAGCTCGTCGAGCTGCAGAAGCAGGCC
CAGGCCCGCCTCGCCAAGACGCGTGAGCGCTTCAATGACGGCATGCGAGACGCCCGTGAGGTTCGCGGCGACCTC
GAATGGACCCAGAAAAAGGTCAGCTCACTGCAGGCCAAAGCCGCCCGCAAGCACCCAAAGGAGCACGGCAAGGCC
CGCGCGCGGTACCCTTCCCCGGAGTGTTGA
Transcript >Ophcf2|05786
ATGTCCGGCCCCTACTCCACCGTCCCCTACTCCATGCCAATGCCCGTCCCCTCCAAGGGCAACCAGTATCCCGCC
TACAGCCAGTACTCCATCTCCCCCCCAGAGTGCGACGACTCCTTCAGCTCCGCCTCGGGCGTCGGCTCCTACAGC
AACAGCGGCTTCACTGCTCCCTCGTCCGGTTACATGGCCTGCTCTGCCGCCGACTATGACAGCACCCGCTCAGCC
AGCGGCGTCGACTTCCAGGAGTACATGCAGGAACGCTTCGCCAACTCCTTCAACCCCATTCCTCTAGACCGCAGC
ATGGCTGTCCAGGCTCAGACGTCCGGAAAGCTCAACGCCAAGCACCGCGAGCTCGTCGAGCTGCAGAAGCAGGCC
CAGGCCCGCCTCGCCAAGACGCGTGAGCGCTTCAATGACGGCATGCGAGACGCCCGTGAGGTTCGCGGCGACCTC
GAATGGACCCAGAAAAAGGTCAGCTCACTGCAGGCCAAAGCCGCCCGCAAGCACCCAAAGGAGCACGGCAAGGCC
CGCGCGCGGTACCCTTCCCCGGAGTGTTGA
Gene >Ophcf2|05786
ATGTCCGGCCCCTACTCCACCGTCCCCTACTCCATGCCAATGCCCGTCCCCTCCAAGGGCAACCAGTATCCCGCC
TACAGCCAGTACTCCATCTCCCCCCCAGAGTGCGACGACTCCTTCAGCTCCGCCTCGGGCGTCGGCTCCTACAGC
AACAGCGGCTTCACTGCTCCCTCGTCCGGTTACATGGCCTGCTCTGCCGCCGACTATGACAGCACCCGCTCAGCC
AGCGGCGTCGACTTCCAGGAGTACATGCAGGAACGCTTCGCCAACTCCTTCAACCCCATTCCTCTAGACCGCAGC
ATGGCTGTCCAGGCTCAGACGTCAGTCTTTCACCCCTCTCTTCTACACCTTGTTCATTATACGAGCTGGTCGCTC
ATCCCGCTGCAGGTCCGGAAAGCTCAACGCCAAGCACCGCGAGCTCGTCGAGCTGCAGAAGCAGGCCCAGGCCCG
CCTCGCCAAGACGCGTGAGCGCTTCAATGACGGCATGCGAGACGCCCGTGAGGTTCGCGGCGACCTCGAATGGAC
CCAGAAAAAGGTCAGCTCACTGCAGGCCAAAGCCGCCCGCAAGCACCCAAAGGAGCACGGCAAGGCCCGCGCGCG
GTACCCTTCCCCGGAGTGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail