Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05777
Gene name
Locationscaffold_06:2225085..2227137
Strand+
Gene length (bp)2052
Transcript length (bp)2052
Coding sequence length (bp)2052
Protein length (aa) 684

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03142 Chitin_synth_2 Chitin synthase 3.2E-25 239 507
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 4.1E-07 298 528

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 76 98 22
2 108 130 22
3 470 492 22
4 507 529 22
5 542 564 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05777
MKDDVLLPPPVTHSTSTRPARGRRRSVRSGEEDDSPDANSDRVSRASTKPPNTPRDGPVLPSPGSRGRKLTSEQL
LLQRIIFISVILVVNIGLGVLIVFADVGYAPLVIMLVFKLQDCLSTMLAVTCLSWKAIRACFSRRRESEPPREGK
WILTLLPAYNESEEQILKALDGLRDNVVLPDRQVVVIVLDGKPKDGLRHGFSTVVSDFSRPYRSLRGRFGILRIT
AGFFPRDLPVMLIEKDGNGGKKDTLVLALDLFNYPRDDMPAYTRLLRHQLWHSVLPPLTADTGFQTVDMMFCTDA
DSQIHEDCIPKLVSTLSSTPNVIAACGLVLVEFEPGSGLSPWNPFQLVQYGYGQFVRRWAESLVGKVTCLPGCVT
MLAVRPEMAGAVADFARPVDSGYVVEHQVQNLGTDRRLTYCMLSQHRDLKTVFVPDAVSETVAPQSFRHYLHQRR
RWGSNAYFNNFFYCRGRNMNLWTRLIALLQIIRQSCVFYRLLNTILFIRALVTSFHLLKILPLLIVGQLPTAWFL
VCLFCQRALRVRIHHLALGFLINKLVSPIMSSIVFAAVATNLGKASWGMSGITASSPAASQRPATASSTGGQRPS
VNSDSAANSLEERGPTSSTMAVERESRPSVDFLEKETSRSSNRSGREQSSTTSSSSESDLPSSTNPFEHPFEKEL
RTTLVFET*
Coding >Ophcf2|05777
ATGAAAGACGACGTCCTCCTCCCCCCGCCCGTCACCCACTCGACGTCAACAAGACCGGCCCGGGGTCGGAGACGA
TCGGTCCGGTCCGGCGAAGAGGACGACTCCCCGGATGCCAACTCGGACCGCGTCTCCCGAGCGTCGACGAAACCC
CCGAATACACCTCGTGACGGGCCCGTTCTCCCCTCGCCCGGCAGCCGGGGCCGGAAACTCACATCCGAGCAACTC
CTCCTCCAGCGAATCATCTTCATCAGCGTCATCCTCGTCGTAAACATCGGGCTCGGAGTCCTCATCGTCTTCGCA
GACGTCGGTTACGCCCCCCTCGTCATCATGCTCGTCTTCAAACTGCAAGACTGCCTCTCCACCATGTTGGCCGTG
ACATGTCTCTCCTGGAAAGCCATCCGCGCTTGCTTCTCCCGGAGAAGAGAGTCGGAGCCGCCGAGGGAAGGGAAA
TGGATCCTCACGCTCCTCCCGGCCTATAATGAGAGCGAGGAGCAGATCCTCAAGGCTCTGGATGGTCTGCGTGAT
AACGTGGTCCTCCCTGATAGACAGGTGGTTGTCATTGTCCTCGACGGGAAGCCCAAGGATGGACTACGGCATGGC
TTCTCTACCGTCGTCAGCGACTTCTCGAGACCATACCGATCGCTTCGAGGCCGCTTCGGAATCCTCCGTATCACG
GCCGGCTTCTTCCCCCGGGACCTGCCGGTGATGCTGATAGAAAAGGACGGCAACGGCGGGAAGAAGGATACCCTG
GTGTTGGCCCTCGATCTCTTCAACTACCCGCGAGACGACATGCCGGCATACACGCGTCTCCTCCGTCACCAACTC
TGGCATTCCGTCCTCCCGCCTCTGACGGCAGACACGGGCTTCCAGACGGTCGACATGATGTTCTGCACCGACGCC
GACTCCCAGATCCACGAGGACTGCATCCCTAAACTCGTCTCAACCCTATCGTCGACCCCAAACGTCATAGCCGCC
TGCGGCCTCGTCCTCGTCGAGTTCGAACCGGGCTCGGGCCTCTCCCCCTGGAACCCGTTCCAACTCGTCCAGTAC
GGCTACGGCCAGTTCGTCCGCCGCTGGGCAGAGTCCCTCGTCGGCAAGGTCACCTGTCTTCCCGGATGCGTCACC
ATGCTGGCCGTTCGGCCCGAGATGGCCGGCGCCGTGGCGGACTTTGCGAGGCCGGTCGATAGCGGCTACGTTGTC
GAGCATCAGGTTCAGAATCTGGGGACGGATAGGAGGCTTACTTACTGTATGCTCAGCCAGCATCGCGACTTGAAG
ACCGTCTTTGTGCCGGATGCTGTTTCCGAGACGGTTGCTCCCCAGTCGTTTCGCCATTATCTTCATCAGAGGAGA
CGATGGGGTTCCAACGCCTACTTCAACAACTTCTTCTATTGTCGAGGCCGCAACATGAATCTCTGGACACGTCTT
ATAGCTCTTCTGCAAATCATCCGCCAAAGCTGCGTCTTCTACCGCCTTCTCAACACCATTCTCTTCATCCGCGCC
CTCGTCACAAGCTTTCACTTGCTCAAGATCCTTCCGCTTCTCATCGTCGGCCAGCTTCCCACCGCCTGGTTCCTC
GTCTGTCTCTTCTGCCAGCGGGCTCTACGCGTCAGGATTCATCACTTGGCCCTCGGCTTCCTCATCAACAAGCTC
GTCTCTCCCATCATGTCGTCCATCGTCTTCGCCGCCGTCGCCACCAACCTCGGCAAGGCGAGCTGGGGCATGAGC
GGTATCACGGCTTCTTCCCCGGCTGCGTCGCAGAGACCGGCCACCGCATCTTCTACGGGGGGGCAGAGGCCTTCC
GTCAACTCTGATTCGGCCGCCAACTCTTTGGAAGAAAGGGGGCCGACGTCGTCGACGATGGCTGTTGAAAGGGAG
TCGAGACCATCCGTCGATTTTTTGGAAAAGGAGACGAGTCGATCGTCGAACCGCTCCGGAAGAGAGCAGAGCTCG
ACAACCTCCTCCTCCTCCGAAAGCGACCTGCCGTCTTCGACAAACCCCTTTGAGCACCCTTTCGAAAAGGAGTTG
AGGACAACACTTGTCTTCGAGACTTGA
Transcript >Ophcf2|05777
ATGAAAGACGACGTCCTCCTCCCCCCGCCCGTCACCCACTCGACGTCAACAAGACCGGCCCGGGGTCGGAGACGA
TCGGTCCGGTCCGGCGAAGAGGACGACTCCCCGGATGCCAACTCGGACCGCGTCTCCCGAGCGTCGACGAAACCC
CCGAATACACCTCGTGACGGGCCCGTTCTCCCCTCGCCCGGCAGCCGGGGCCGGAAACTCACATCCGAGCAACTC
CTCCTCCAGCGAATCATCTTCATCAGCGTCATCCTCGTCGTAAACATCGGGCTCGGAGTCCTCATCGTCTTCGCA
GACGTCGGTTACGCCCCCCTCGTCATCATGCTCGTCTTCAAACTGCAAGACTGCCTCTCCACCATGTTGGCCGTG
ACATGTCTCTCCTGGAAAGCCATCCGCGCTTGCTTCTCCCGGAGAAGAGAGTCGGAGCCGCCGAGGGAAGGGAAA
TGGATCCTCACGCTCCTCCCGGCCTATAATGAGAGCGAGGAGCAGATCCTCAAGGCTCTGGATGGTCTGCGTGAT
AACGTGGTCCTCCCTGATAGACAGGTGGTTGTCATTGTCCTCGACGGGAAGCCCAAGGATGGACTACGGCATGGC
TTCTCTACCGTCGTCAGCGACTTCTCGAGACCATACCGATCGCTTCGAGGCCGCTTCGGAATCCTCCGTATCACG
GCCGGCTTCTTCCCCCGGGACCTGCCGGTGATGCTGATAGAAAAGGACGGCAACGGCGGGAAGAAGGATACCCTG
GTGTTGGCCCTCGATCTCTTCAACTACCCGCGAGACGACATGCCGGCATACACGCGTCTCCTCCGTCACCAACTC
TGGCATTCCGTCCTCCCGCCTCTGACGGCAGACACGGGCTTCCAGACGGTCGACATGATGTTCTGCACCGACGCC
GACTCCCAGATCCACGAGGACTGCATCCCTAAACTCGTCTCAACCCTATCGTCGACCCCAAACGTCATAGCCGCC
TGCGGCCTCGTCCTCGTCGAGTTCGAACCGGGCTCGGGCCTCTCCCCCTGGAACCCGTTCCAACTCGTCCAGTAC
GGCTACGGCCAGTTCGTCCGCCGCTGGGCAGAGTCCCTCGTCGGCAAGGTCACCTGTCTTCCCGGATGCGTCACC
ATGCTGGCCGTTCGGCCCGAGATGGCCGGCGCCGTGGCGGACTTTGCGAGGCCGGTCGATAGCGGCTACGTTGTC
GAGCATCAGGTTCAGAATCTGGGGACGGATAGGAGGCTTACTTACTGTATGCTCAGCCAGCATCGCGACTTGAAG
ACCGTCTTTGTGCCGGATGCTGTTTCCGAGACGGTTGCTCCCCAGTCGTTTCGCCATTATCTTCATCAGAGGAGA
CGATGGGGTTCCAACGCCTACTTCAACAACTTCTTCTATTGTCGAGGCCGCAACATGAATCTCTGGACACGTCTT
ATAGCTCTTCTGCAAATCATCCGCCAAAGCTGCGTCTTCTACCGCCTTCTCAACACCATTCTCTTCATCCGCGCC
CTCGTCACAAGCTTTCACTTGCTCAAGATCCTTCCGCTTCTCATCGTCGGCCAGCTTCCCACCGCCTGGTTCCTC
GTCTGTCTCTTCTGCCAGCGGGCTCTACGCGTCAGGATTCATCACTTGGCCCTCGGCTTCCTCATCAACAAGCTC
GTCTCTCCCATCATGTCGTCCATCGTCTTCGCCGCCGTCGCCACCAACCTCGGCAAGGCGAGCTGGGGCATGAGC
GGTATCACGGCTTCTTCCCCGGCTGCGTCGCAGAGACCGGCCACCGCATCTTCTACGGGGGGGCAGAGGCCTTCC
GTCAACTCTGATTCGGCCGCCAACTCTTTGGAAGAAAGGGGGCCGACGTCGTCGACGATGGCTGTTGAAAGGGAG
TCGAGACCATCCGTCGATTTTTTGGAAAAGGAGACGAGTCGATCGTCGAACCGCTCCGGAAGAGAGCAGAGCTCG
ACAACCTCCTCCTCCTCCGAAAGCGACCTGCCGTCTTCGACAAACCCCTTTGAGCACCCTTTCGAAAAGGAGTTG
AGGACAACACTTGTCTTCGAGACTTGA
Gene >Ophcf2|05777
ATGAAAGACGACGTCCTCCTCCCCCCGCCCGTCACCCACTCGACGTCAACAAGACCGGCCCGGGGTCGGAGACGA
TCGGTCCGGTCCGGCGAAGAGGACGACTCCCCGGATGCCAACTCGGACCGCGTCTCCCGAGCGTCGACGAAACCC
CCGAATACACCTCGTGACGGGCCCGTTCTCCCCTCGCCCGGCAGCCGGGGCCGGAAACTCACATCCGAGCAACTC
CTCCTCCAGCGAATCATCTTCATCAGCGTCATCCTCGTCGTAAACATCGGGCTCGGAGTCCTCATCGTCTTCGCA
GACGTCGGTTACGCCCCCCTCGTCATCATGCTCGTCTTCAAACTGCAAGACTGCCTCTCCACCATGTTGGCCGTG
ACATGTCTCTCCTGGAAAGCCATCCGCGCTTGCTTCTCCCGGAGAAGAGAGTCGGAGCCGCCGAGGGAAGGGAAA
TGGATCCTCACGCTCCTCCCGGCCTATAATGAGAGCGAGGAGCAGATCCTCAAGGCTCTGGATGGTCTGCGTGAT
AACGTGGTCCTCCCTGATAGACAGGTGGTTGTCATTGTCCTCGACGGGAAGCCCAAGGATGGACTACGGCATGGC
TTCTCTACCGTCGTCAGCGACTTCTCGAGACCATACCGATCGCTTCGAGGCCGCTTCGGAATCCTCCGTATCACG
GCCGGCTTCTTCCCCCGGGACCTGCCGGTGATGCTGATAGAAAAGGACGGCAACGGCGGGAAGAAGGATACCCTG
GTGTTGGCCCTCGATCTCTTCAACTACCCGCGAGACGACATGCCGGCATACACGCGTCTCCTCCGTCACCAACTC
TGGCATTCCGTCCTCCCGCCTCTGACGGCAGACACGGGCTTCCAGACGGTCGACATGATGTTCTGCACCGACGCC
GACTCCCAGATCCACGAGGACTGCATCCCTAAACTCGTCTCAACCCTATCGTCGACCCCAAACGTCATAGCCGCC
TGCGGCCTCGTCCTCGTCGAGTTCGAACCGGGCTCGGGCCTCTCCCCCTGGAACCCGTTCCAACTCGTCCAGTAC
GGCTACGGCCAGTTCGTCCGCCGCTGGGCAGAGTCCCTCGTCGGCAAGGTCACCTGTCTTCCCGGATGCGTCACC
ATGCTGGCCGTTCGGCCCGAGATGGCCGGCGCCGTGGCGGACTTTGCGAGGCCGGTCGATAGCGGCTACGTTGTC
GAGCATCAGGTTCAGAATCTGGGGACGGATAGGAGGCTTACTTACTGTATGCTCAGCCAGCATCGCGACTTGAAG
ACCGTCTTTGTGCCGGATGCTGTTTCCGAGACGGTTGCTCCCCAGTCGTTTCGCCATTATCTTCATCAGAGGAGA
CGATGGGGTTCCAACGCCTACTTCAACAACTTCTTCTATTGTCGAGGCCGCAACATGAATCTCTGGACACGTCTT
ATAGCTCTTCTGCAAATCATCCGCCAAAGCTGCGTCTTCTACCGCCTTCTCAACACCATTCTCTTCATCCGCGCC
CTCGTCACAAGCTTTCACTTGCTCAAGATCCTTCCGCTTCTCATCGTCGGCCAGCTTCCCACCGCCTGGTTCCTC
GTCTGTCTCTTCTGCCAGCGGGCTCTACGCGTCAGGATTCATCACTTGGCCCTCGGCTTCCTCATCAACAAGCTC
GTCTCTCCCATCATGTCGTCCATCGTCTTCGCCGCCGTCGCCACCAACCTCGGCAAGGCGAGCTGGGGCATGAGC
GGTATCACGGCTTCTTCCCCGGCTGCGTCGCAGAGACCGGCCACCGCATCTTCTACGGGGGGGCAGAGGCCTTCC
GTCAACTCTGATTCGGCCGCCAACTCTTTGGAAGAAAGGGGGCCGACGTCGTCGACGATGGCTGTTGAAAGGGAG
TCGAGACCATCCGTCGATTTTTTGGAAAAGGAGACGAGTCGATCGTCGAACCGCTCCGGAAGAGAGCAGAGCTCG
ACAACCTCCTCCTCCTCCGAAAGCGACCTGCCGTCTTCGACAAACCCCTTTGAGCACCCTTTCGAAAAGGAGTTG
AGGACAACACTTGTCTTCGAGACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail