Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05776
Gene name
Locationscaffold_06:2221411..2223585
Strand-
Gene length (bp)2174
Transcript length (bp)1065
Coding sequence length (bp)1065
Protein length (aa) 355

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00984 UDPG_MGDP_dh UDP-glucose/GDP-mannose dehydrogenase family, central domain 2.5E-18 147 218

GO

GO Term Description Terminal node
GO:0051287 NAD binding Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0000166 nucleotide binding No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:1901265 nucleoside phosphate binding No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.6719 0.4851 0.1031 0.0585 0.4642 0.1094 0.0975 0.2614 0.2087 0.0604

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup484
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1871
Ophiocordyceps australis map64 (Brazil) OphauB2|7347
Ophiocordyceps camponoti-floridani Ophcf2|05776 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1148
Ophiocordyceps kimflemingae Ophio5|5242
Ophiocordyceps subramaniannii Hirsu2|10824
Ophiocordyceps subramaniannii Hirsu2|8429
Ophiocordyceps subramaniannii Hirsu2|9170

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05776
MGNLNNQFIESHDGKQQPTPPETTFSGPSPSSPIDTTAEAVVAVLGVGYVGTHLVDVFSRRFHTIGFDLSAKRLR
EVESLFDGRRVCLTSEPAELERATRRPRPLRSQAIPKLISGLDDITPGSLSSIYSLYASVFDRVVPVSRPEVAEM
TKLYENCQRMMCIAYVNEMADACLPHRIDPFEVCRAAATKPFGYMPYLPGVGVGGHCIPVNPHYLLSNSAFPLLA
AASEAMARRPSVIADRIVERIERGGKRSSCERAKVLVVGVGFKAGQSTLSNSPGLSLARRLSESNMVQVCFADPL
VRQGEVPSIARLADGDWNRETLSGFDLVVVTIRQPGLDLTLLDGLDGVDVEWWC*
Coding >Ophcf2|05776
ATGGGTAATCTCAACAACCAGTTCATCGAAAGCCATGACGGCAAACAGCAACCCACCCCCCCCGAAACCACCTTC
TCAGGCCCCTCCCCTTCCTCCCCCATCGACACCACAGCCGAAGCCGTCGTCGCCGTCCTGGGCGTCGGCTACGTC
GGAACCCACCTCGTCGACGTCTTCTCACGCCGTTTCCACACCATCGGCTTCGACCTGTCTGCCAAGCGGTTGCGA
GAGGTCGAGAGCCTGTTTGACGGACGGCGAGTCTGTCTGACGAGCGAGCCTGCCGAGTTGGAGAGGGCCACGCGT
CGACCCCGGCCGCTCCGATCCCAAGCCATCCCCAAACTCATCTCCGGCCTCGACGACATAACCCCCGGCTCCCTC
TCTTCCATCTACAGCCTCTACGCCTCCGTCTTCGACCGCGTCGTCCCCGTCTCCAGACCCGAAGTGGCGGAGATG
ACCAAGCTGTACGAGAACTGCCAGCGCATGATGTGCATCGCCTACGTCAACGAGATGGCCGACGCCTGTCTCCCT
CACCGGATCGATCCCTTCGAGGTCTGTCGGGCGGCCGCTACCAAGCCCTTTGGTTATATGCCTTACCTCCCCGGT
GTCGGTGTAGGGGGTCACTGTATCCCTGTTAACCCGCACTATCTGCTGTCCAACAGCGCGTTTCCCCTGCTGGCA
GCTGCGAGCGAGGCCATGGCCCGTCGACCGTCCGTCATCGCCGACCGTATCGTCGAGAGGATCGAGAGAGGTGGA
AAGAGGAGTAGTTGTGAAAGGGCCAAGGTTCTCGTCGTCGGCGTCGGCTTCAAGGCCGGCCAGTCGACGCTCAGC
AACTCGCCCGGCCTCTCCCTGGCCCGGCGTCTATCCGAGTCGAACATGGTGCAAGTCTGCTTTGCTGATCCGCTG
GTTCGGCAGGGAGAGGTGCCTAGCATTGCCCGGTTGGCCGACGGGGACTGGAATAGGGAGACGTTGTCGGGGTTT
GACCTTGTTGTCGTTACTATTCGTCAGCCGGGGCTTGACTTGACGCTGCTTGATGGTCTAGACGGTGTGGATGTC
GAGTGGTGGTGTTAG
Transcript >Ophcf2|05776
ATGGGTAATCTCAACAACCAGTTCATCGAAAGCCATGACGGCAAACAGCAACCCACCCCCCCCGAAACCACCTTC
TCAGGCCCCTCCCCTTCCTCCCCCATCGACACCACAGCCGAAGCCGTCGTCGCCGTCCTGGGCGTCGGCTACGTC
GGAACCCACCTCGTCGACGTCTTCTCACGCCGTTTCCACACCATCGGCTTCGACCTGTCTGCCAAGCGGTTGCGA
GAGGTCGAGAGCCTGTTTGACGGACGGCGAGTCTGTCTGACGAGCGAGCCTGCCGAGTTGGAGAGGGCCACGCGT
CGACCCCGGCCGCTCCGATCCCAAGCCATCCCCAAACTCATCTCCGGCCTCGACGACATAACCCCCGGCTCCCTC
TCTTCCATCTACAGCCTCTACGCCTCCGTCTTCGACCGCGTCGTCCCCGTCTCCAGACCCGAAGTGGCGGAGATG
ACCAAGCTGTACGAGAACTGCCAGCGCATGATGTGCATCGCCTACGTCAACGAGATGGCCGACGCCTGTCTCCCT
CACCGGATCGATCCCTTCGAGGTCTGTCGGGCGGCCGCTACCAAGCCCTTTGGTTATATGCCTTACCTCCCCGGT
GTCGGTGTAGGGGGTCACTGTATCCCTGTTAACCCGCACTATCTGCTGTCCAACAGCGCGTTTCCCCTGCTGGCA
GCTGCGAGCGAGGCCATGGCCCGTCGACCGTCCGTCATCGCCGACCGTATCGTCGAGAGGATCGAGAGAGGTGGA
AAGAGGAGTAGTTGTGAAAGGGCCAAGGTTCTCGTCGTCGGCGTCGGCTTCAAGGCCGGCCAGTCGACGCTCAGC
AACTCGCCCGGCCTCTCCCTGGCCCGGCGTCTATCCGAGTCGAACATGGTGCAAGTCTGCTTTGCTGATCCGCTG
GTTCGGCAGGGAGAGGTGCCTAGCATTGCCCGGTTGGCCGACGGGGACTGGAATAGGGAGACGTTGTCGGGGTTT
GACCTTGTTGTCGTTACTATTCGTCAGCCGGGGCTTGACTTGACGCTGCTTGATGGTCTAGACGGTGTGGATGTC
GAGTGGTGGTGTTAG
Gene >Ophcf2|05776
ATGGGTAATCTCAAGTCCGTGCTGTCCTGGTTATATATCTACATACATACATCCAAGCCGGCTTCCCCCTTCTCC
CGTGCCTCTCGGACGATAGCAACCAGTTCATCGAAAGCCATGACGGCAAACAGCAACCGTCCGTCCTTCCCGGAC
CTCCCCTCCTCCCCATCCCTCTCCTGCATCACCAACCATGTCCTCCCAGCACCCCCCCCGAAACCACCTTCTCAG
GCCCCTCCCCTTCCTCCCCCATCGACACCACAGCCGAAGCCGTCGTCGCCGTCCTGGGCGTCGGCTACGTCGGAA
CCCACCTCGTCGACGTCTTCTCACGCCGTTTCCACACCATCGGCTTCGACCTGTCTGCCAAGCGGTTGCGAGAGG
TCGAGAGCCTGTTTGACGGACGGCGAGTCTGTCTGACGAGCGAGCCTGCCGAGTTGGAGAGGGCCAGTCACTTTC
TCGTCGCGGTGCCTACCTTGCTTCTTCCCGGGGAGGGGAGCGGTGGGAGGGTGGATGCGTCGTTTCTGCAGGGGG
CCTTGGATGTGGTTGCTGCTCGTGCGAGGCCTGGATCGACTGTCGTTATAGAGAGCTCGGTTGCTGTTGGCATGA
CGAGAAGGCTGCTGGGACCGTTGGCCGGGGCTCGGGGCTGGTTCGCGGGTATGTCGCCCGAGGTGAGTGTTGAAT
ATGTCTCTTTGGATATGTGTCTGGCGCAGCTTGATCTTTGACATCTCTTGCCTTTTCTTCAACACCTTTTCTTCT
ACCAACCCTCTTCCCAACTCTCTTTAACGCATCCCCATTAATACATACATTCTCTTCAACCAACCCTCTTCAAAC
AACCCTCTTTAACCACCCCTCTCCAACCACCCCTCTTCACCCCTCTCCACAAACTCTCTTCAACACATCCCCATC
AATACATACATTCTCTTCAACCAGTCCTCTTCAACCAACTCTCTCCAACCAACCCTCTTCACCAACCCTCTTCAA
CCAACCCTCTTCAACCAACCCTCTTCACCCTACCCTCTTCACCAACCCTCTTCAACCAGTCCTCTTCAACCAACT
CTCTCCAACCAACCCTCTTCACCAACCCTCTTCACCCTACCCTCTTCAACCAACCCTCTTCAACCAACCCTCTTC
ACCAACCCTCTTCAACCAACCCTCTTCAACCAACCCTCTTCACCCTACCCTCTTCACCAACCCTCTTCAACCAAC
CCTCTCCAACCAACCCTCTCCAACCAACCCTCTCCAACCAACCCTCTCCAACCAACCCTCTCCAACCAACCCTCT
CCAACCAACCCTCTCCAACCAACCCTCTCCAACCAACCCTCTCCAACCAACCCTCTCCACCCCTCTCCAACAACT
CTCCTCAACCCCCAAACTCCTGCTAACTCACTCACTCCACCCACCCCCCCCCAGCGCGTCGACCCCGGCCGCTCC
GATCCCAAGCCATCCCCAAACTCATCTCCGGCCTCGACGACATAACCCCCGGCTCCCTCTCTTCCATCTACAGCC
TCTACGCCTCCGTCTTCGACCGCGTCGTCCCCGTCTCCAGACCCGAAGTGGCGGAGATGACCAAGCTGTACGAGA
ACTGCCAGCGCATGATGTGCATCGCCTACGTCAACGAGATGGCCGACGCCTGTCTCCCTCACCGGATCGATCCCT
TCGAGGTCTGTCGGGCGGCCGCTACCAAGCCCTTTGGTTATATGCCTTACCTCCCCGGTGTCGGTGTAGGGGGTC
ACTGTATCCCTGTTAACCCGCACTATCTGCTGTCCAACAGCGCGTTTCCCCTGCTGGCAGCTGCGAGCGAGGCCA
TGGCCCGTCGACCGTCCGTCATCGCCGACCGTATCGTCGAGAGGATCGAGAGAGGTGGAAAGAGGAGTAGTTGTG
AAAGGGCCAAGGTTCTCGTCGTCGGCGTCGGCTTCAAGGCCGGCCAGTCGACGCTCAGCAACTCGCCCGGCCTCT
CCCTGGCCCGGCGTCTATCCGAGTCGAACATGGTGCAAGTCTGCTTTGCTGATCCGCTGGTTCGGCAGGGAGAGG
TGCCTAGCATTGCCCGGTTGGCCGACGGGGACTGGAATAGGGAGACGTTGTCGGGGTTTGACCTTGTTGTCGTTA
CTATTCGTCAGCCGGGGCTTGACTTGACGCTGCTTGATGGTCTAGACGGTGTGGATGTCGAGTGGTGGTGTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail