Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05775
Gene name
Locationscaffold_06:2220310..2221117
Strand+
Gene length (bp)807
Transcript length (bp)807
Coding sequence length (bp)807
Protein length (aa) 269

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08787 Alginate_lyase2 Alginate lyase 1.3E-29 31 249

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1224 0.053 0.9127 0.0618 0.0782 0.0603 0.2137 0.2298 0.1481 0.0155

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
PL7_4 1.4E-47 31 250

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5179
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|05775 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1149
Ophiocordyceps kimflemingae Ophio5|5241
Ophiocordyceps subramaniannii Hirsu2|3899
Ophiocordyceps subramaniannii Hirsu2|9813

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05775
MLFPKLVPLLVGLGHADVKSYRFDCNPGGNFDLRGWNLQLPELSGGSFKVVRSDELQGCDGYRDEKYFFTDGLTG
AMVLKAPGNPNVTGCTTTPSSNHCRTELREVDPRNGRNMNWTSGHVNLLDATIAVVKADDGSLGTSVAQVFAKGA
SLSALYVDQGGNISLDIKLRNPGKRRRVVKIGEVPLGSRFNFTMSYSNHVLRLWLNGVESEKVRVELPPAAGCSF
KLGNYNQGKSGGESEVHVFAIGLEHRRNDDSLEVKSLVSPSAG*
Coding >Ophcf2|05775
ATGCTCTTCCCGAAATTAGTCCCCCTCCTCGTCGGACTCGGTCACGCCGACGTCAAGAGCTACAGGTTCGACTGC
AACCCCGGAGGCAACTTTGACCTCCGAGGCTGGAACTTGCAGCTCCCCGAGCTCTCCGGAGGCTCCTTCAAGGTG
GTGCGAAGCGACGAACTGCAGGGCTGCGACGGTTATCGTGACGAGAAATACTTCTTTACGGATGGCCTCACGGGG
GCCATGGTTCTCAAGGCGCCTGGGAACCCCAACGTGACGGGCTGTACGACGACGCCTAGCAGCAACCACTGCCGC
ACCGAGCTTCGAGAGGTCGACCCTCGCAACGGGAGGAACATGAACTGGACATCTGGGCATGTCAACTTGCTCGAT
GCCACCATTGCCGTCGTCAAGGCGGATGACGGCTCGCTTGGGACGTCGGTGGCTCAGGTGTTTGCCAAAGGGGCT
TCTCTTTCGGCTCTTTACGTCGACCAAGGTGGCAACATCAGCTTGGATATCAAGCTCAGGAATCCCGGGAAGCGT
AGACGAGTTGTCAAGATCGGAGAGGTTCCGCTCGGGAGCCGCTTCAACTTTACCATGTCGTACTCGAATCATGTG
CTTCGGCTGTGGCTCAACGGTGTCGAGTCCGAAAAGGTCCGTGTTGAGCTTCCACCGGCTGCTGGTTGTTCTTTC
AAGCTGGGGAATTATAATCAGGGCAAGTCGGGTGGCGAGTCTGAGGTTCATGTCTTTGCCATTGGGTTGGAGCAC
CGGCGCAACGACGACAGCTTGGAGGTGAAGAGCCTTGTTTCACCGTCGGCGGGTTAG
Transcript >Ophcf2|05775
ATGCTCTTCCCGAAATTAGTCCCCCTCCTCGTCGGACTCGGTCACGCCGACGTCAAGAGCTACAGGTTCGACTGC
AACCCCGGAGGCAACTTTGACCTCCGAGGCTGGAACTTGCAGCTCCCCGAGCTCTCCGGAGGCTCCTTCAAGGTG
GTGCGAAGCGACGAACTGCAGGGCTGCGACGGTTATCGTGACGAGAAATACTTCTTTACGGATGGCCTCACGGGG
GCCATGGTTCTCAAGGCGCCTGGGAACCCCAACGTGACGGGCTGTACGACGACGCCTAGCAGCAACCACTGCCGC
ACCGAGCTTCGAGAGGTCGACCCTCGCAACGGGAGGAACATGAACTGGACATCTGGGCATGTCAACTTGCTCGAT
GCCACCATTGCCGTCGTCAAGGCGGATGACGGCTCGCTTGGGACGTCGGTGGCTCAGGTGTTTGCCAAAGGGGCT
TCTCTTTCGGCTCTTTACGTCGACCAAGGTGGCAACATCAGCTTGGATATCAAGCTCAGGAATCCCGGGAAGCGT
AGACGAGTTGTCAAGATCGGAGAGGTTCCGCTCGGGAGCCGCTTCAACTTTACCATGTCGTACTCGAATCATGTG
CTTCGGCTGTGGCTCAACGGTGTCGAGTCCGAAAAGGTCCGTGTTGAGCTTCCACCGGCTGCTGGTTGTTCTTTC
AAGCTGGGGAATTATAATCAGGGCAAGTCGGGTGGCGAGTCTGAGGTTCATGTCTTTGCCATTGGGTTGGAGCAC
CGGCGCAACGACGACAGCTTGGAGGTGAAGAGCCTTGTTTCACCGTCGGCGGGTTAG
Gene >Ophcf2|05775
ATGCTCTTCCCGAAATTAGTCCCCCTCCTCGTCGGACTCGGTCACGCCGACGTCAAGAGCTACAGGTTCGACTGC
AACCCCGGAGGCAACTTTGACCTCCGAGGCTGGAACTTGCAGCTCCCCGAGCTCTCCGGAGGCTCCTTCAAGGTG
GTGCGAAGCGACGAACTGCAGGGCTGCGACGGTTATCGTGACGAGAAATACTTCTTTACGGATGGCCTCACGGGG
GCCATGGTTCTCAAGGCGCCTGGGAACCCCAACGTGACGGGCTGTACGACGACGCCTAGCAGCAACCACTGCCGC
ACCGAGCTTCGAGAGGTCGACCCTCGCAACGGGAGGAACATGAACTGGACATCTGGGCATGTCAACTTGCTCGAT
GCCACCATTGCCGTCGTCAAGGCGGATGACGGCTCGCTTGGGACGTCGGTGGCTCAGGTGTTTGCCAAAGGGGCT
TCTCTTTCGGCTCTTTACGTCGACCAAGGTGGCAACATCAGCTTGGATATCAAGCTCAGGAATCCCGGGAAGCGT
AGACGAGTTGTCAAGATCGGAGAGGTTCCGCTCGGGAGCCGCTTCAACTTTACCATGTCGTACTCGAATCATGTG
CTTCGGCTGTGGCTCAACGGTGTCGAGTCCGAAAAGGTCCGTGTTGAGCTTCCACCGGCTGCTGGTTGTTCTTTC
AAGCTGGGGAATTATAATCAGGGCAAGTCGGGTGGCGAGTCTGAGGTTCATGTCTTTGCCATTGGGTTGGAGCAC
CGGCGCAACGACGACAGCTTGGAGGTGAAGAGCCTTGTTTCACCGTCGGCGGGTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail