Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05774
Gene name
Locationscaffold_06:2217952..2219617
Strand+
Gene length (bp)1665
Transcript length (bp)1545
Coding sequence length (bp)1545
Protein length (aa) 515

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09949 APP1_cat Phosphatidate phosphatase APP1, catalytic domain 2.5E-35 276 421

GO

GO Term Description Terminal node
GO:0008195 phosphatidate phosphatase activity Yes
GO:0042578 phosphoric ester hydrolase activity No
GO:0003824 catalytic activity No
GO:0016791 phosphatase activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.0703 0.0535 0.7824 0.3481 0.089 0.0232 0.3292 0.3842 0.2843 0.0055

SignalP

SignalP signal predicted Location Score
Yes 1 - 22 0.999702

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6030
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|05774 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6941
Ophiocordyceps kimflemingae Ophio5|5240
Ophiocordyceps subramaniannii Hirsu2|1199

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05774
MMPPPPPLPLLLLVALAPVAICSPTPSPTPQLVVPGIVPAPTSTPGPGAVEARGLGDAKSYLSSLAGEAGSKVAS
FVDSGVLDFPRGFPTGTEVEKQAGVSASEVEARPTEVLNIPPYANWTDQGWNVRVHGNVYRTPNISQEKIDKLAN
VFLVGVDVDELQPGEQAQARNLTRAIFVVGEGNRSVTMDFVNDVEVRANASGGAVNASGGAQTVQLPFNTTRQGD
FDVFIPLKNTTSNGRGLIPGNETSRVQTINLYAQGTDTGNATAYLVPPRGVTIISDIDDILRVTKIYQPKEGLLN
TFARPFRPWMNMPDIYANWSRSVPDAHFHYLTTTPEQGTRLYMDFIYKTYPLGSFDTRPLNFSDVEATLSIRKFL
LEKVISTFPERKFVLVADTSNRDVMRDYPLMYREHPEQVTCILLRNTSATDESDKFPYDTKGFRDVPREKYMFFT
VPDDLVGLNIMGGRCVNASVRQNVTFRTQGLPFGIGDGESGAARGVGRLGWAVVVALVSAVVWG*
Coding >Ophcf2|05774
ATGATGCCGCCGCCGCCGCCGCTGCCGCTGCTGCTGCTGGTGGCGCTCGCCCCCGTCGCCATCTGCAGTCCGACC
CCTTCGCCGACGCCGCAGCTGGTGGTCCCCGGTATCGTTCCGGCCCCGACTTCGACGCCGGGCCCGGGAGCGGTG
GAGGCGCGCGGCCTCGGCGATGCCAAGAGTTACCTGTCCAGCCTGGCGGGCGAGGCGGGCAGCAAGGTGGCTTCT
TTTGTCGACTCTGGCGTCCTGGATTTTCCGCGAGGGTTTCCTACTGGGACAGAGGTTGAGAAGCAGGCCGGCGTG
TCGGCTTCTGAGGTGGAGGCGAGGCCCACTGAGGTTCTCAACATCCCGCCTTATGCCAACTGGACGGACCAAGGC
TGGAACGTGCGCGTGCATGGAAACGTCTACCGCACGCCCAACATCTCGCAAGAGAAGATTGATAAGCTGGCCAAC
GTCTTTCTCGTTGGAGTCGACGTCGATGAGTTGCAGCCGGGGGAGCAGGCGCAGGCGCGGAACCTGACGCGTGCC
ATCTTCGTGGTTGGGGAGGGGAATCGGAGCGTGACGATGGATTTTGTGAATGATGTTGAGGTGAGGGCGAATGCT
TCGGGCGGTGCTGTCAATGCTAGTGGAGGAGCGCAGACGGTTCAGTTACCCTTCAACACGACCAGACAGGGCGAC
TTCGACGTCTTCATCCCGCTCAAGAACACGACAAGCAACGGCCGCGGCCTCATTCCCGGAAACGAAACCTCTCGC
GTTCAGACAATCAACCTCTACGCTCAGGGCACAGACACAGGCAACGCGACCGCCTATCTCGTCCCCCCCCGCGGC
GTGACCATCATCTCCGACATCGACGACATCCTCCGCGTCACGAAAATCTACCAGCCGAAAGAAGGCCTCCTCAAC
ACCTTTGCCCGTCCATTCCGTCCGTGGATGAACATGCCGGACATCTACGCCAACTGGTCGCGGTCCGTCCCGGAC
GCTCACTTTCACTACCTCACCACCACGCCCGAGCAGGGGACGCGTCTGTACATGGATTTCATATACAAGACTTAC
CCGCTCGGCTCCTTCGATACGCGGCCTTTGAACTTTTCGGACGTCGAGGCTACGTTGTCGATTCGCAAGTTCTTG
CTGGAAAAGGTGATTTCTACCTTTCCCGAGAGGAAGTTTGTGCTGGTGGCCGATACTTCGAACCGGGATGTCATG
AGAGATTACCCTCTCATGTACCGCGAGCATCCGGAGCAGGTAACCTGCATCCTCCTCCGCAACACGAGCGCAACA
GACGAATCCGATAAGTTCCCCTACGATACCAAGGGGTTCCGAGACGTGCCTCGCGAGAAATACATGTTCTTCACC
GTTCCGGATGACTTGGTGGGCTTGAACATCATGGGGGGGCGGTGCGTGAATGCGTCTGTCAGGCAGAACGTCACC
TTTCGGACGCAGGGGTTGCCGTTTGGGATCGGGGATGGGGAGAGTGGTGCTGCGAGGGGGGTTGGGCGGTTGGGA
TGGGCGGTTGTCGTTGCTCTGGTTTCGGCGGTTGTTTGGGGGTGA
Transcript >Ophcf2|05774
ATGATGCCGCCGCCGCCGCCGCTGCCGCTGCTGCTGCTGGTGGCGCTCGCCCCCGTCGCCATCTGCAGTCCGACC
CCTTCGCCGACGCCGCAGCTGGTGGTCCCCGGTATCGTTCCGGCCCCGACTTCGACGCCGGGCCCGGGAGCGGTG
GAGGCGCGCGGCCTCGGCGATGCCAAGAGTTACCTGTCCAGCCTGGCGGGCGAGGCGGGCAGCAAGGTGGCTTCT
TTTGTCGACTCTGGCGTCCTGGATTTTCCGCGAGGGTTTCCTACTGGGACAGAGGTTGAGAAGCAGGCCGGCGTG
TCGGCTTCTGAGGTGGAGGCGAGGCCCACTGAGGTTCTCAACATCCCGCCTTATGCCAACTGGACGGACCAAGGC
TGGAACGTGCGCGTGCATGGAAACGTCTACCGCACGCCCAACATCTCGCAAGAGAAGATTGATAAGCTGGCCAAC
GTCTTTCTCGTTGGAGTCGACGTCGATGAGTTGCAGCCGGGGGAGCAGGCGCAGGCGCGGAACCTGACGCGTGCC
ATCTTCGTGGTTGGGGAGGGGAATCGGAGCGTGACGATGGATTTTGTGAATGATGTTGAGGTGAGGGCGAATGCT
TCGGGCGGTGCTGTCAATGCTAGTGGAGGAGCGCAGACGGTTCAGTTACCCTTCAACACGACCAGACAGGGCGAC
TTCGACGTCTTCATCCCGCTCAAGAACACGACAAGCAACGGCCGCGGCCTCATTCCCGGAAACGAAACCTCTCGC
GTTCAGACAATCAACCTCTACGCTCAGGGCACAGACACAGGCAACGCGACCGCCTATCTCGTCCCCCCCCGCGGC
GTGACCATCATCTCCGACATCGACGACATCCTCCGCGTCACGAAAATCTACCAGCCGAAAGAAGGCCTCCTCAAC
ACCTTTGCCCGTCCATTCCGTCCGTGGATGAACATGCCGGACATCTACGCCAACTGGTCGCGGTCCGTCCCGGAC
GCTCACTTTCACTACCTCACCACCACGCCCGAGCAGGGGACGCGTCTGTACATGGATTTCATATACAAGACTTAC
CCGCTCGGCTCCTTCGATACGCGGCCTTTGAACTTTTCGGACGTCGAGGCTACGTTGTCGATTCGCAAGTTCTTG
CTGGAAAAGGTGATTTCTACCTTTCCCGAGAGGAAGTTTGTGCTGGTGGCCGATACTTCGAACCGGGATGTCATG
AGAGATTACCCTCTCATGTACCGCGAGCATCCGGAGCAGGTAACCTGCATCCTCCTCCGCAACACGAGCGCAACA
GACGAATCCGATAAGTTCCCCTACGATACCAAGGGGTTCCGAGACGTGCCTCGCGAGAAATACATGTTCTTCACC
GTTCCGGATGACTTGGTGGGCTTGAACATCATGGGGGGGCGGTGCGTGAATGCGTCTGTCAGGCAGAACGTCACC
TTTCGGACGCAGGGGTTGCCGTTTGGGATCGGGGATGGGGAGAGTGGTGCTGCGAGGGGGGTTGGGCGGTTGGGA
TGGGCGGTTGTCGTTGCTCTGGTTTCGGCGGTTGTTTGGGGGTGA
Gene >Ophcf2|05774
ATGATGCCGCCGCCGCCGCCGCTGCCGCTGCTGCTGCTGGTGGCGCTCGCCCCCGTCGCCATCTGCAGTCCGACC
CCTTCGCCGACGCCGCAGCTGGTGGTCCCCGGTATCGTTCCGGCCCCGACTTCGACGCCGGGCCCGGGAGCGGTG
GAGGCGCGCGGCCTCGGCGATGCCAAGAGTTACCTGTCCAGCCTGGCGGGCGAGGCGGGCAGCAAGGTGGCTTCT
TTTGTCGACTCTGGCGTCCTGGATTTTCCGCGAGGGTTTCCTACTGGGACAGAGGTTGAGAAGCAGGCCGGCGTG
TCGGCTTCTGAGGTGGAGGCGAGGCCCACTGAGGTTCTCAACATCCCGTGAGTGGTCTCCCCCGTTTGCTCTATA
GACGTTGTGTGGCTAAAGTGAGAACAGGCCTTATGCCAACTGGACGGACCAAGGCTGGAACGTGCGCGTGCATGG
AAACGTCTACCGCACGCCCAACATCTCGCAAGAGAAGATTGATAAGCTGGCCAACGTCTTTCTCGTTGGAGTCGA
CGTCGATGAGTTGCAGCCGGGGGAGCAGGCGCAGGCGCGGAACCTGACGCGTGCCATCTTCGTGGTTGGGGAGGG
GAATCGGAGCGTGACGATGGATTTTGTGAATGATGTTGAGGTGAGGGCGAATGCTTCGGGCGGTGCTGTCAATGC
TGTGAGTTCTTCTTGTTAGGGTTATCACGAGTTGTGTGTGTGACTCTGTCTGACGAGCTTTGACAGAGTGGAGGA
GCGCAGACGGTTCAGTTACCCTTCAACACGACCAGACAGGGCGACTTCGACGTCTTCATCCCGCTCAAGAACACG
ACAAGCAACGGCCGCGGCCTCATTCCCGGAAACGAAACCTCTCGCGTTCAGACAATCAACCTCTACGCTCAGGGC
ACAGACACAGGCAACGCGACCGCCTATCTCGTCCCCCCCCGCGGCGTGACCATCATCTCCGACATCGACGACATC
CTCCGCGTCACGAAAATCTACCAGCCGAAAGAAGGCCTCCTCAACACCTTTGCCCGTCCATTCCGTCCGTGGATG
AACATGCCGGACATCTACGCCAACTGGTCGCGGTCCGTCCCGGACGCTCACTTTCACTACCTCACCACCACGCCC
GAGCAGGGGACGCGTCTGTACATGGATTTCATATACAAGACTTACCCGCTCGGCTCCTTCGATACGCGGCCTTTG
AACTTTTCGGACGTCGAGGCTACGTTGTCGATTCGCAAGTTCTTGCTGGAAAAGGTGATTTCTACCTTTCCCGAG
AGGAAGTTTGTGCTGGTGGCCGATACTTCGAACCGGGATGTCATGAGAGATTACCCTCTCATGTACCGCGAGCAT
CCGGAGCAGGTAACCTGCATCCTCCTCCGCAACACGAGCGCAACAGACGAATCCGATAAGTTCCCCTACGATACC
AAGGGGTTCCGAGACGTGCCTCGCGAGAAATACATGTTCTTCACCGTTCCGGATGACTTGGTGGGCTTGAACATC
ATGGGGGGGCGGTGCGTGAATGCGTCTGTCAGGCAGAACGTCACCTTTCGGACGCAGGGGTTGCCGTTTGGGATC
GGGGATGGGGAGAGTGGTGCTGCGAGGGGGGTTGGGCGGTTGGGATGGGCGGTTGTCGTTGCTCTGGTTTCGGCG
GTTGTTTGGGGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail