Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05773
Gene name
Locationscaffold_06:2213122..2215921
Strand-
Gene length (bp)2799
Transcript length (bp)2688
Coding sequence length (bp)2688
Protein length (aa) 896

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10363 RTP1_C1 Required for nuclear transport of RNA pol II C-terminus 1 1.0E-24 557 657
PF10304 RTP1_C2 Required for nuclear transport of RNA pol II C-terminus 2 1.7E-07 847 869

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.6201 0.6789 0.0352 0.0715 0.149 0.0163 0.1328 0.092 0.2921 0.0453

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1584
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|21
Ophiocordyceps australis map64 (Brazil) OphauB2|2682
Ophiocordyceps camponoti-floridani Ophcf2|05773 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6942
Ophiocordyceps kimflemingae Ophio5|5239
Ophiocordyceps subramaniannii Hirsu2|1200

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05773
MAETQPRPTIAQELVTAATRAYDPSSSAETREAGVLEYDAIVASAATWVLLPVLNSLIKPDLLPRWMREPLLRTL
TFLPLRPDGVRSTLEFVFSVHPSSQQQETEQPQKSGASITHEAVAVGTKLLSSVPPSTTPDDWFKALSGQVLHLL
DGKAGKDLGRVVAQVVGFGILGQRQFGAPGAPGWNVFVQPLIEAVNPSLVPEGRPLGTEANDGDVTILSLDRVIV
SAQQLETALHRLNLLTLSNSSPGLCRRILRPIIVQLWALCSWSQPPEAAETRFVSPARSLVQTHLRLFGKLDSIS
PLVQNLVCTGADTCEPATLCSPKQLRPQWCYRLNGGGEMEIALRPKQDESVKLVWNEVEYKASVLVEMMASACSS
QEIAAVFLHYLDRWIQTARERPLQVQITAVPLTEDAGSALQQLIEVTLLQRLMMQAPEKLVGHVKQLMEVICQVL
AGDGQWPLGDDVISVVLSLLNLVITAAGFQKDNLAADQVKTLEEALDRLGGENRPEVSPTAKNLGMLLRYRDELE
ETDEDRCRASQRHEEDQKTYRLAMSYITGKGDNPPPVVSEGLDLLSKLVVAESAVLDIQAVAVLMSSLLKESDDF
INLRVIKVFTQLANKHPKTTVQELLDGYLDVQEKASTDVRLRFGEALMQVIERLGETFCGPLAERVCEALMSVAG
RRGFRPKTMAKQAREERLHELKKRKAGEAMEEEAMDEEEKEKEEEAAEAKELEQETEETADRALLAQIVEGWEGK
RGSEDVRMRASALSILGAGLESNIGGISAAIVSQTVDLCSQVLTLERGPEQGILRRAAVVGILSLTLALDGADRA
DGAPSSCSHLSLTSSGRTELQRRLAYVADTDTDGLVRQQARDAADSLANLTLRDVSGWISSGSRRIDEVQ*
Coding >Ophcf2|05773
ATGGCTGAGACGCAACCTCGGCCTACGATAGCTCAAGAGCTCGTCACCGCCGCTACCCGAGCCTATGACCCGTCC
TCATCTGCCGAAACCCGCGAGGCAGGCGTCCTAGAATACGACGCCATCGTTGCGAGTGCCGCTACGTGGGTTCTC
CTACCCGTCCTCAACTCTCTCATCAAGCCAGACCTTTTGCCTCGGTGGATGAGAGAGCCCCTGCTGCGCACCCTC
ACCTTCCTACCCCTACGACCCGACGGCGTGCGCTCTACGCTCGAGTTCGTCTTTTCCGTCCACCCGAGCAGCCAG
CAGCAGGAAACGGAGCAGCCACAGAAGAGCGGCGCAAGCATCACGCACGAGGCCGTTGCCGTCGGCACGAAGCTG
CTGTCCTCGGTGCCGCCTAGCACGACGCCGGATGACTGGTTCAAAGCCCTCTCTGGCCAGGTGCTGCATCTTCTC
GACGGCAAGGCGGGTAAGGACCTGGGCAGAGTCGTCGCCCAGGTTGTCGGATTCGGAATCCTCGGCCAGAGGCAG
TTTGGCGCTCCTGGAGCGCCGGGATGGAACGTCTTTGTACAGCCGCTCATCGAAGCCGTGAACCCTTCTCTCGTG
CCAGAAGGCAGGCCCCTCGGCACGGAAGCCAACGACGGCGACGTGACGATCCTGAGTCTCGATAGAGTCATCGTC
TCAGCCCAGCAGCTGGAAACTGCGCTCCATCGTCTCAACCTGCTGACCCTGTCCAACTCGTCTCCGGGCTTGTGC
AGGAGAATTCTCAGGCCCATCATCGTCCAGCTCTGGGCACTCTGCTCGTGGAGTCAGCCGCCGGAAGCCGCGGAG
ACACGGTTCGTCAGTCCGGCCCGCAGTCTCGTGCAGACTCATCTCCGCCTGTTCGGCAAGCTGGATAGCATATCT
CCCTTGGTGCAGAATCTTGTCTGCACAGGCGCCGACACTTGCGAGCCCGCGACGCTCTGCTCACCAAAGCAGCTC
CGGCCACAGTGGTGCTATCGTCTAAATGGCGGCGGCGAGATGGAGATTGCGTTACGCCCAAAGCAAGACGAAAGT
GTGAAGCTCGTCTGGAACGAGGTCGAGTACAAGGCATCCGTCCTGGTTGAAATGATGGCGAGCGCCTGCTCCAGC
CAGGAAATTGCCGCCGTCTTCCTCCACTATCTCGATAGGTGGATACAAACGGCGCGGGAACGGCCCCTCCAAGTG
CAGATCACGGCCGTGCCTCTGACGGAAGATGCCGGATCCGCCCTGCAGCAGCTCATCGAGGTCACGCTGCTGCAG
AGGCTGATGATGCAGGCGCCGGAGAAGCTCGTCGGCCATGTAAAGCAGCTGATGGAGGTAATCTGTCAAGTACTG
GCAGGCGACGGACAATGGCCTCTCGGTGACGACGTCATCTCTGTCGTCCTGAGCCTGCTCAACCTCGTCATCACG
GCGGCGGGCTTTCAGAAGGACAATCTGGCAGCGGATCAGGTCAAGACGCTGGAGGAGGCTCTCGACAGGCTGGGC
GGCGAGAACCGACCGGAGGTGTCGCCAACGGCCAAGAACCTCGGCATGCTACTCAGATATCGCGACGAGCTGGAG
GAGACGGACGAGGACAGATGCAGGGCGAGTCAACGGCACGAAGAAGACCAAAAGACGTACAGACTAGCCATGAGT
TACATTACCGGCAAGGGCGACAACCCACCGCCGGTAGTGTCGGAGGGCCTCGACCTGCTGTCCAAGCTGGTGGTA
GCGGAAAGCGCGGTGCTCGACATCCAGGCGGTGGCGGTGTTGATGTCGAGCCTGCTCAAGGAGTCGGATGACTTT
ATCAACCTGAGGGTCATCAAGGTGTTTACGCAGTTGGCCAACAAGCATCCCAAGACGACGGTACAGGAGCTGCTG
GACGGCTACCTCGACGTGCAGGAGAAGGCGTCGACGGACGTTCGGCTCCGATTCGGAGAGGCGCTGATGCAGGTC
ATTGAGCGGCTGGGAGAGACTTTCTGCGGACCCCTAGCAGAGCGAGTATGCGAGGCGCTCATGTCGGTGGCCGGA
CGAAGGGGATTCCGACCCAAGACGATGGCCAAGCAGGCGCGGGAGGAACGGCTGCATGAGCTGAAGAAGCGCAAG
GCAGGGGAGGCGATGGAAGAGGAGGCGATGGATGAAGAGGAGAAGGAAAAGGAGGAGGAGGCGGCGGAGGCGAAG
GAACTGGAACAGGAGACGGAAGAAACGGCAGACAGGGCCCTGCTTGCGCAGATTGTCGAGGGATGGGAGGGCAAG
CGGGGCAGCGAAGACGTGCGGATGCGTGCATCGGCGCTGTCCATCCTTGGAGCCGGGCTGGAGAGTAACATCGGG
GGCATATCAGCAGCCATTGTTTCGCAAACGGTCGATCTCTGCTCACAGGTGCTGACACTTGAGCGCGGACCAGAG
CAGGGCATCCTCCGGCGCGCAGCCGTGGTGGGCATCCTCAGCCTGACCCTCGCCCTAGACGGGGCGGACAGGGCG
GACGGGGCGCCCTCGTCATGCTCGCACCTATCGCTGACGTCTTCGGGCCGCACAGAGCTGCAGCGACGGCTGGCG
TACGTGGCGGACACGGACACGGACGGCCTGGTACGGCAGCAGGCGCGCGACGCGGCAGATAGCCTTGCCAACCTG
ACGCTCCGCGACGTGTCGGGGTGGATATCATCTGGCTCGCGGCGCATCGACGAAGTTCAATGA
Transcript >Ophcf2|05773
ATGGCTGAGACGCAACCTCGGCCTACGATAGCTCAAGAGCTCGTCACCGCCGCTACCCGAGCCTATGACCCGTCC
TCATCTGCCGAAACCCGCGAGGCAGGCGTCCTAGAATACGACGCCATCGTTGCGAGTGCCGCTACGTGGGTTCTC
CTACCCGTCCTCAACTCTCTCATCAAGCCAGACCTTTTGCCTCGGTGGATGAGAGAGCCCCTGCTGCGCACCCTC
ACCTTCCTACCCCTACGACCCGACGGCGTGCGCTCTACGCTCGAGTTCGTCTTTTCCGTCCACCCGAGCAGCCAG
CAGCAGGAAACGGAGCAGCCACAGAAGAGCGGCGCAAGCATCACGCACGAGGCCGTTGCCGTCGGCACGAAGCTG
CTGTCCTCGGTGCCGCCTAGCACGACGCCGGATGACTGGTTCAAAGCCCTCTCTGGCCAGGTGCTGCATCTTCTC
GACGGCAAGGCGGGTAAGGACCTGGGCAGAGTCGTCGCCCAGGTTGTCGGATTCGGAATCCTCGGCCAGAGGCAG
TTTGGCGCTCCTGGAGCGCCGGGATGGAACGTCTTTGTACAGCCGCTCATCGAAGCCGTGAACCCTTCTCTCGTG
CCAGAAGGCAGGCCCCTCGGCACGGAAGCCAACGACGGCGACGTGACGATCCTGAGTCTCGATAGAGTCATCGTC
TCAGCCCAGCAGCTGGAAACTGCGCTCCATCGTCTCAACCTGCTGACCCTGTCCAACTCGTCTCCGGGCTTGTGC
AGGAGAATTCTCAGGCCCATCATCGTCCAGCTCTGGGCACTCTGCTCGTGGAGTCAGCCGCCGGAAGCCGCGGAG
ACACGGTTCGTCAGTCCGGCCCGCAGTCTCGTGCAGACTCATCTCCGCCTGTTCGGCAAGCTGGATAGCATATCT
CCCTTGGTGCAGAATCTTGTCTGCACAGGCGCCGACACTTGCGAGCCCGCGACGCTCTGCTCACCAAAGCAGCTC
CGGCCACAGTGGTGCTATCGTCTAAATGGCGGCGGCGAGATGGAGATTGCGTTACGCCCAAAGCAAGACGAAAGT
GTGAAGCTCGTCTGGAACGAGGTCGAGTACAAGGCATCCGTCCTGGTTGAAATGATGGCGAGCGCCTGCTCCAGC
CAGGAAATTGCCGCCGTCTTCCTCCACTATCTCGATAGGTGGATACAAACGGCGCGGGAACGGCCCCTCCAAGTG
CAGATCACGGCCGTGCCTCTGACGGAAGATGCCGGATCCGCCCTGCAGCAGCTCATCGAGGTCACGCTGCTGCAG
AGGCTGATGATGCAGGCGCCGGAGAAGCTCGTCGGCCATGTAAAGCAGCTGATGGAGGTAATCTGTCAAGTACTG
GCAGGCGACGGACAATGGCCTCTCGGTGACGACGTCATCTCTGTCGTCCTGAGCCTGCTCAACCTCGTCATCACG
GCGGCGGGCTTTCAGAAGGACAATCTGGCAGCGGATCAGGTCAAGACGCTGGAGGAGGCTCTCGACAGGCTGGGC
GGCGAGAACCGACCGGAGGTGTCGCCAACGGCCAAGAACCTCGGCATGCTACTCAGATATCGCGACGAGCTGGAG
GAGACGGACGAGGACAGATGCAGGGCGAGTCAACGGCACGAAGAAGACCAAAAGACGTACAGACTAGCCATGAGT
TACATTACCGGCAAGGGCGACAACCCACCGCCGGTAGTGTCGGAGGGCCTCGACCTGCTGTCCAAGCTGGTGGTA
GCGGAAAGCGCGGTGCTCGACATCCAGGCGGTGGCGGTGTTGATGTCGAGCCTGCTCAAGGAGTCGGATGACTTT
ATCAACCTGAGGGTCATCAAGGTGTTTACGCAGTTGGCCAACAAGCATCCCAAGACGACGGTACAGGAGCTGCTG
GACGGCTACCTCGACGTGCAGGAGAAGGCGTCGACGGACGTTCGGCTCCGATTCGGAGAGGCGCTGATGCAGGTC
ATTGAGCGGCTGGGAGAGACTTTCTGCGGACCCCTAGCAGAGCGAGTATGCGAGGCGCTCATGTCGGTGGCCGGA
CGAAGGGGATTCCGACCCAAGACGATGGCCAAGCAGGCGCGGGAGGAACGGCTGCATGAGCTGAAGAAGCGCAAG
GCAGGGGAGGCGATGGAAGAGGAGGCGATGGATGAAGAGGAGAAGGAAAAGGAGGAGGAGGCGGCGGAGGCGAAG
GAACTGGAACAGGAGACGGAAGAAACGGCAGACAGGGCCCTGCTTGCGCAGATTGTCGAGGGATGGGAGGGCAAG
CGGGGCAGCGAAGACGTGCGGATGCGTGCATCGGCGCTGTCCATCCTTGGAGCCGGGCTGGAGAGTAACATCGGG
GGCATATCAGCAGCCATTGTTTCGCAAACGGTCGATCTCTGCTCACAGGTGCTGACACTTGAGCGCGGACCAGAG
CAGGGCATCCTCCGGCGCGCAGCCGTGGTGGGCATCCTCAGCCTGACCCTCGCCCTAGACGGGGCGGACAGGGCG
GACGGGGCGCCCTCGTCATGCTCGCACCTATCGCTGACGTCTTCGGGCCGCACAGAGCTGCAGCGACGGCTGGCG
TACGTGGCGGACACGGACACGGACGGCCTGGTACGGCAGCAGGCGCGCGACGCGGCAGATAGCCTTGCCAACCTG
ACGCTCCGCGACGTGTCGGGGTGGATATCATCTGGCTCGCGGCGCATCGACGAAGTTCAATGA
Gene >Ophcf2|05773
ATGGCTGAGACGCAACCTCGGCCTACGATAGCTCAAGAGCTCGTCACCGCCGCTACCCGAGCCTATGACCCGTCC
TCATCTGCCGAAACCCGCGAGGCAGGCGTCCTAGAATACGACGCCATCGTTGCGAGGTGATTGCCCATGCCACTC
ATCATTCGCCGAGCTAAACCTCTCGACATCCTCTCAGTGCCGCTACGTGGGTTCTCCTACCCGTCCTCAACTCTC
TCATCAAGCCAGACCTTTTGCCTCGGTGGATGAGAGAGCCCCTGCTGCGCACCCTCACCTTCCTACCCCTACGAC
CCGACGGCGTGCGCTCTACGCTCGAGTTCGTCTTTTCCGTCCACCCGAGCAGCCAGCAGCAGGAAACGGAGCAGC
CACAGAAGAGCGGCGCAAGCATCACGCACGAGGCCGTTGCCGTCGGCACGAAGCTGCTGTCCTCGGTGCCGCCTA
GCACGACGCCGGATGACTGGTTCAAAGCCCTCTCTGGCCAGGTGCTGCATCTTCTCGACGGCAAGGCGGGTAAGG
ACCTGGGCAGAGTCGTCGCCCAGGTTGTCGGATTCGGAATCCTCGGCCAGAGGCAGTTTGGCGCTCCTGGTACGG
ACTTTGACCCCCTTCTCGATACCGAGCCGTGTTGCTGACGGCAGGATAGGAGCGCCGGGATGGAACGTCTTTGTA
CAGCCGCTCATCGAAGCCGTGAACCCTTCTCTCGTGCCAGAAGGCAGGCCCCTCGGCACGGAAGCCAACGACGGC
GACGTGACGATCCTGAGTCTCGATAGAGTCATCGTCTCAGCCCAGCAGCTGGAAACTGCGCTCCATCGTCTCAAC
CTGCTGACCCTGTCCAACTCGTCTCCGGGCTTGTGCAGGAGAATTCTCAGGCCCATCATCGTCCAGCTCTGGGCA
CTCTGCTCGTGGAGTCAGCCGCCGGAAGCCGCGGAGACACGGTTCGTCAGTCCGGCCCGCAGTCTCGTGCAGACT
CATCTCCGCCTGTTCGGCAAGCTGGATAGCATATCTCCCTTGGTGCAGAATCTTGTCTGCACAGGCGCCGACACT
TGCGAGCCCGCGACGCTCTGCTCACCAAAGCAGCTCCGGCCACAGTGGTGCTATCGTCTAAATGGCGGCGGCGAG
ATGGAGATTGCGTTACGCCCAAAGCAAGACGAAAGTGTGAAGCTCGTCTGGAACGAGGTCGAGTACAAGGCATCC
GTCCTGGTTGAAATGATGGCGAGCGCCTGCTCCAGCCAGGAAATTGCCGCCGTCTTCCTCCACTATCTCGATAGG
TGGATACAAACGGCGCGGGAACGGCCCCTCCAAGTGCAGATCACGGCCGTGCCTCTGACGGAAGATGCCGGATCC
GCCCTGCAGCAGCTCATCGAGGTCACGCTGCTGCAGAGGCTGATGATGCAGGCGCCGGAGAAGCTCGTCGGCCAT
GTAAAGCAGCTGATGGAGGTAATCTGTCAAGTACTGGCAGGCGACGGACAATGGCCTCTCGGTGACGACGTCATC
TCTGTCGTCCTGAGCCTGCTCAACCTCGTCATCACGGCGGCGGGCTTTCAGAAGGACAATCTGGCAGCGGATCAG
GTCAAGACGCTGGAGGAGGCTCTCGACAGGCTGGGCGGCGAGAACCGACCGGAGGTGTCGCCAACGGCCAAGAAC
CTCGGCATGCTACTCAGATATCGCGACGAGCTGGAGGAGACGGACGAGGACAGATGCAGGGCGAGTCAACGGCAC
GAAGAAGACCAAAAGACGTACAGACTAGCCATGAGTTACATTACCGGCAAGGGCGACAACCCACCGCCGGTAGTG
TCGGAGGGCCTCGACCTGCTGTCCAAGCTGGTGGTAGCGGAAAGCGCGGTGCTCGACATCCAGGCGGTGGCGGTG
TTGATGTCGAGCCTGCTCAAGGAGTCGGATGACTTTATCAACCTGAGGGTCATCAAGGTGTTTACGCAGTTGGCC
AACAAGCATCCCAAGACGACGGTACAGGAGCTGCTGGACGGCTACCTCGACGTGCAGGAGAAGGCGTCGACGGAC
GTTCGGCTCCGATTCGGAGAGGCGCTGATGCAGGTCATTGAGCGGCTGGGAGAGACTTTCTGCGGACCCCTAGCA
GAGCGAGTATGCGAGGCGCTCATGTCGGTGGCCGGACGAAGGGGATTCCGACCCAAGACGATGGCCAAGCAGGCG
CGGGAGGAACGGCTGCATGAGCTGAAGAAGCGCAAGGCAGGGGAGGCGATGGAAGAGGAGGCGATGGATGAAGAG
GAGAAGGAAAAGGAGGAGGAGGCGGCGGAGGCGAAGGAACTGGAACAGGAGACGGAAGAAACGGCAGACAGGGCC
CTGCTTGCGCAGATTGTCGAGGGATGGGAGGGCAAGCGGGGCAGCGAAGACGTGCGGATGCGTGCATCGGCGCTG
TCCATCCTTGGAGCCGGGCTGGAGAGTAACATCGGGGGCATATCAGCAGCCATTGTTTCGCAAACGGTCGATCTC
TGCTCACAGGTGCTGACACTTGAGCGCGGACCAGAGCAGGGCATCCTCCGGCGCGCAGCCGTGGTGGGCATCCTC
AGCCTGACCCTCGCCCTAGACGGGGCGGACAGGGCGGACGGGGCGCCCTCGTCATGCTCGCACCTATCGCTGACG
TCTTCGGGCCGCACAGAGCTGCAGCGACGGCTGGCGTACGTGGCGGACACGGACACGGACGGCCTGGTACGGCAG
CAGGCGCGCGACGCGGCAGATAGCCTTGCCAACCTGACGCTCCGCGACGTGTCGGGGTGGATATCATCTGGCTCG
CGGCGCATCGACGAAGTTCAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail