Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05764
Gene name
Locationscaffold_06:2196175..2198225
Strand+
Gene length (bp)2050
Transcript length (bp)1986
Coding sequence length (bp)1986
Protein length (aa) 662

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00285 Citrate_synt Citrate synthase, C-terminal domain 5.0E-17 434 628
PF02629 CoA_binding CoA binding domain 5.0E-18 43 148
PF00549 Ligase_CoA CoA-ligase 4.2E-14 208 331

GO

GO Term Description Terminal node
GO:0046912 acyltransferase activity, acyl groups converted into alkyl on transfer Yes
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No
GO:0016746 acyltransferase activity No
GO:0016740 transferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7009 0.3872 0.0388 0.0581 0.2472 0.0334 0.0429 0.1304 0.0531 0.1576

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1546
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|29
Ophiocordyceps australis map64 (Brazil) OphauB2|1569
Ophiocordyceps camponoti-floridani Ophcf2|05764 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7343
Ophiocordyceps kimflemingae Ophio5|5973
Ophiocordyceps subramaniannii Hirsu2|1127

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05764
MAQASNTNGNGAKGQLSANDNIQRFAAPSRPLSPLPAHALFNDKTRCFVYGLQPRAVQGMLDFDFICKRKTPSVA
GIIYPFGGQFVSKMYWGTSETLLPVYQEIDKAMSKHPDVDVVVNFASSRSVYSSTMELMGNPQIKTIAIIAEGVP
ERRAREIAHVARKKHVTIIGPATVGGIKPGSFKIGNTGGMMDNIVSSKLYRKGSVAYVSKSGGMSNELNNIISHH
TDGVYEGIAIGGDRYPGTTFVDHMLRFQADPDCKILVLLGEVGGVEEYKVIDAVKKGVIKKPIVAWAIGTCASMF
KTEVQFGHAGSFANSQLETAAMKNKTMREAGIHVPDSFEDMPALLKKVYQKLVQEGTIKPQPEPVVPKIPIDYSW
AQELGLIRKPAAFISTISDDRGQELLYAGMPISDVFKEDIGIGGVMSLLWFRRRLPVYASKFLEMVLMLTADHGP
AVSGAMNTIITTRAGKDLISALVSGLLTIGSRFGGALDGAADEFTRAFDKNLSPREFVDSMRKANKLIPGIGHRV
KSRNNPDLRVELVKEYVLAKFPSHKLLDYALAVETVTTSKKDNLILNVDGCIAVCFVDLLRNCGAFSAEEAEDYL
QMGVLNGLFVLGRSIGLIAHFLDQKRLRTGLYRHPWDDITYLLPNLREGRPGAEGRVEVQM*
Coding >Ophcf2|05764
ATGGCTCAAGCCTCAAATACCAACGGCAACGGCGCCAAAGGCCAGCTCTCCGCAAACGATAATATCCAGCGATTT
GCCGCCCCCAGCCGTCCGCTGAGTCCGCTGCCTGCTCATGCCCTCTTCAACGACAAGACGCGATGCTTCGTCTAC
GGCCTCCAACCAAGGGCCGTCCAGGGCATGCTCGACTTCGACTTCATCTGCAAGCGCAAGACGCCCTCGGTCGCC
GGCATCATCTACCCCTTTGGCGGCCAGTTCGTCAGCAAGATGTACTGGGGCACCAGCGAGACTCTGCTGCCCGTC
TACCAGGAGATCGACAAGGCCATGAGCAAGCATCCCGACGTCGACGTCGTCGTCAACTTTGCCTCGTCCCGCAGC
GTCTATAGCTCCACCATGGAGCTCATGGGGAACCCCCAGATCAAGACGATTGCCATCATCGCCGAGGGCGTCCCC
GAGCGGCGAGCCCGAGAGATTGCCCACGTGGCCCGCAAGAAGCATGTCACCATCATCGGTCCCGCAACCGTTGGC
GGCATCAAGCCCGGTAGCTTCAAGATCGGGAATACGGGCGGCATGATGGACAACATCGTCTCCTCCAAGCTCTAC
CGCAAGGGGTCCGTCGCCTACGTTTCCAAGTCTGGCGGCATGTCCAATGAGCTCAACAACATCATTTCCCACCAC
ACCGACGGCGTCTACGAGGGCATCGCCATTGGCGGTGACAGGTACCCCGGCACCACCTTCGTCGACCACATGCTC
CGATTCCAGGCCGATCCCGACTGCAAGATCCTCGTCTTACTGGGCGAGGTCGGAGGCGTCGAGGAGTACAAGGTC
ATCGATGCCGTCAAGAAGGGCGTCATCAAGAAGCCCATCGTCGCCTGGGCCATCGGCACCTGCGCCAGCATGTTC
AAGACCGAGGTTCAGTTCGGCCATGCCGGCTCCTTTGCCAATTCGCAACTCGAGACGGCCGCCATGAAGAATAAG
ACGATGCGTGAGGCCGGCATCCACGTCCCGGACTCGTTCGAGGACATGCCCGCCCTGCTCAAGAAAGTCTACCAG
AAACTGGTCCAGGAGGGCACCATCAAGCCCCAGCCCGAGCCCGTCGTGCCCAAGATTCCCATCGACTACTCGTGG
GCGCAGGAGCTCGGCCTCATTCGGAAGCCGGCCGCCTTCATCTCGACCATCTCGGACGACCGCGGCCAGGAGCTC
CTCTACGCCGGCATGCCCATCTCGGACGTCTTCAAGGAGGACATTGGCATCGGCGGCGTCATGTCGCTCCTCTGG
TTCCGTCGCAGGCTGCCCGTCTACGCATCCAAGTTCCTCGAGATGGTGCTCATGCTGACGGCCGACCACGGTCCC
GCCGTGTCCGGCGCCATGAACACCATCATCACTACCCGCGCCGGCAAGGACCTCATCAGCGCCCTCGTCTCGGGC
CTGCTGACCATCGGTTCCCGCTTCGGCGGTGCCCTGGACGGCGCCGCCGACGAGTTCACCCGGGCCTTTGACAAG
AACCTCAGCCCGCGCGAGTTTGTCGATAGCATGCGCAAGGCCAACAAGCTCATCCCGGGCATCGGTCACCGCGTC
AAGTCGCGCAACAACCCGGACCTCCGGGTCGAGCTGGTCAAGGAGTACGTCTTGGCCAAGTTCCCCAGCCACAAG
CTCCTCGACTACGCCCTGGCCGTCGAGACGGTGACGACGTCCAAGAAGGACAACCTGATCCTCAACGTCGACGGT
TGCATCGCCGTCTGTTTCGTCGACCTGCTGCGCAACTGCGGCGCCTTTTCTGCCGAGGAGGCCGAGGACTACCTG
CAGATGGGCGTCCTCAACGGCCTGTTCGTGCTCGGCCGCAGCATCGGCCTCATCGCCCACTTCCTCGACCAGAAG
AGGCTGCGGACCGGTCTGTACCGCCACCCGTGGGATGACATCACCTACCTGCTGCCCAACCTGCGAGAGGGACGG
CCGGGCGCCGAGGGCAGAGTCGAGGTGCAGATGTAG
Transcript >Ophcf2|05764
ATGGCTCAAGCCTCAAATACCAACGGCAACGGCGCCAAAGGCCAGCTCTCCGCAAACGATAATATCCAGCGATTT
GCCGCCCCCAGCCGTCCGCTGAGTCCGCTGCCTGCTCATGCCCTCTTCAACGACAAGACGCGATGCTTCGTCTAC
GGCCTCCAACCAAGGGCCGTCCAGGGCATGCTCGACTTCGACTTCATCTGCAAGCGCAAGACGCCCTCGGTCGCC
GGCATCATCTACCCCTTTGGCGGCCAGTTCGTCAGCAAGATGTACTGGGGCACCAGCGAGACTCTGCTGCCCGTC
TACCAGGAGATCGACAAGGCCATGAGCAAGCATCCCGACGTCGACGTCGTCGTCAACTTTGCCTCGTCCCGCAGC
GTCTATAGCTCCACCATGGAGCTCATGGGGAACCCCCAGATCAAGACGATTGCCATCATCGCCGAGGGCGTCCCC
GAGCGGCGAGCCCGAGAGATTGCCCACGTGGCCCGCAAGAAGCATGTCACCATCATCGGTCCCGCAACCGTTGGC
GGCATCAAGCCCGGTAGCTTCAAGATCGGGAATACGGGCGGCATGATGGACAACATCGTCTCCTCCAAGCTCTAC
CGCAAGGGGTCCGTCGCCTACGTTTCCAAGTCTGGCGGCATGTCCAATGAGCTCAACAACATCATTTCCCACCAC
ACCGACGGCGTCTACGAGGGCATCGCCATTGGCGGTGACAGGTACCCCGGCACCACCTTCGTCGACCACATGCTC
CGATTCCAGGCCGATCCCGACTGCAAGATCCTCGTCTTACTGGGCGAGGTCGGAGGCGTCGAGGAGTACAAGGTC
ATCGATGCCGTCAAGAAGGGCGTCATCAAGAAGCCCATCGTCGCCTGGGCCATCGGCACCTGCGCCAGCATGTTC
AAGACCGAGGTTCAGTTCGGCCATGCCGGCTCCTTTGCCAATTCGCAACTCGAGACGGCCGCCATGAAGAATAAG
ACGATGCGTGAGGCCGGCATCCACGTCCCGGACTCGTTCGAGGACATGCCCGCCCTGCTCAAGAAAGTCTACCAG
AAACTGGTCCAGGAGGGCACCATCAAGCCCCAGCCCGAGCCCGTCGTGCCCAAGATTCCCATCGACTACTCGTGG
GCGCAGGAGCTCGGCCTCATTCGGAAGCCGGCCGCCTTCATCTCGACCATCTCGGACGACCGCGGCCAGGAGCTC
CTCTACGCCGGCATGCCCATCTCGGACGTCTTCAAGGAGGACATTGGCATCGGCGGCGTCATGTCGCTCCTCTGG
TTCCGTCGCAGGCTGCCCGTCTACGCATCCAAGTTCCTCGAGATGGTGCTCATGCTGACGGCCGACCACGGTCCC
GCCGTGTCCGGCGCCATGAACACCATCATCACTACCCGCGCCGGCAAGGACCTCATCAGCGCCCTCGTCTCGGGC
CTGCTGACCATCGGTTCCCGCTTCGGCGGTGCCCTGGACGGCGCCGCCGACGAGTTCACCCGGGCCTTTGACAAG
AACCTCAGCCCGCGCGAGTTTGTCGATAGCATGCGCAAGGCCAACAAGCTCATCCCGGGCATCGGTCACCGCGTC
AAGTCGCGCAACAACCCGGACCTCCGGGTCGAGCTGGTCAAGGAGTACGTCTTGGCCAAGTTCCCCAGCCACAAG
CTCCTCGACTACGCCCTGGCCGTCGAGACGGTGACGACGTCCAAGAAGGACAACCTGATCCTCAACGTCGACGGT
TGCATCGCCGTCTGTTTCGTCGACCTGCTGCGCAACTGCGGCGCCTTTTCTGCCGAGGAGGCCGAGGACTACCTG
CAGATGGGCGTCCTCAACGGCCTGTTCGTGCTCGGCCGCAGCATCGGCCTCATCGCCCACTTCCTCGACCAGAAG
AGGCTGCGGACCGGTCTGTACCGCCACCCGTGGGATGACATCACCTACCTGCTGCCCAACCTGCGAGAGGGACGG
CCGGGCGCCGAGGGCAGAGTCGAGGTGCAGATGTAG
Gene >Ophcf2|05764
ATGGCTCAAGCCTCAAATACCAACGGCAACGGCGCCAAAGGCCAGCTCTCCGCAAACGATAATATCCAGCGATTT
GCCGCCCCCAGCCGTCCGCTGAGTCCGCTGCCTGCTCATGCCCTCTTCAACGACAAGACGCGATGCTTCGTCTAC
GGCCTCCAACCAAGGGCCGTCCAGGGCATGCTCGACTTCGACTTCATCTGCAAGCGCAAGACGCCCTCGGTCGCC
GGCATCATCTACCCCTTTGGCGGCCAGTTCGTCAGCAAGATGTACTGGGGCACCAGCGAGACTCTGCTGCCCGTC
TACCAGGAGATCGACAAGGCCATGAGCAAGCATCCCGACGTCGACGTCGTCGTCAACTTTGCCTCGTCCCGCAGC
GTCTATAGCTCCACCATGGAGCTCATGGGGAACCCCCAGATCAAGACGATTGCCATCATCGCCGAGGGCGTCCCC
GAGCGGGTGAGCGGCCTTCATTCCTCCTCATTCGTTCTCCAAAACCTCGGCCTAACTTCCTCCCCTTTAGCGAGC
CCGAGAGATTGCCCACGTGGCCCGCAAGAAGCATGTCACCATCATCGGTCCCGCAACCGTTGGCGGCATCAAGCC
CGGTAGCTTCAAGATCGGGAATACGGGCGGCATGATGGACAACATCGTCTCCTCCAAGCTCTACCGCAAGGGGTC
CGTCGCCTACGTTTCCAAGTCTGGCGGCATGTCCAATGAGCTCAACAACATCATTTCCCACCACACCGACGGCGT
CTACGAGGGCATCGCCATTGGCGGTGACAGGTACCCCGGCACCACCTTCGTCGACCACATGCTCCGATTCCAGGC
CGATCCCGACTGCAAGATCCTCGTCTTACTGGGCGAGGTCGGAGGCGTCGAGGAGTACAAGGTCATCGATGCCGT
CAAGAAGGGCGTCATCAAGAAGCCCATCGTCGCCTGGGCCATCGGCACCTGCGCCAGCATGTTCAAGACCGAGGT
TCAGTTCGGCCATGCCGGCTCCTTTGCCAATTCGCAACTCGAGACGGCCGCCATGAAGAATAAGACGATGCGTGA
GGCCGGCATCCACGTCCCGGACTCGTTCGAGGACATGCCCGCCCTGCTCAAGAAAGTCTACCAGAAACTGGTCCA
GGAGGGCACCATCAAGCCCCAGCCCGAGCCCGTCGTGCCCAAGATTCCCATCGACTACTCGTGGGCGCAGGAGCT
CGGCCTCATTCGGAAGCCGGCCGCCTTCATCTCGACCATCTCGGACGACCGCGGCCAGGAGCTCCTCTACGCCGG
CATGCCCATCTCGGACGTCTTCAAGGAGGACATTGGCATCGGCGGCGTCATGTCGCTCCTCTGGTTCCGTCGCAG
GCTGCCCGTCTACGCATCCAAGTTCCTCGAGATGGTGCTCATGCTGACGGCCGACCACGGTCCCGCCGTGTCCGG
CGCCATGAACACCATCATCACTACCCGCGCCGGCAAGGACCTCATCAGCGCCCTCGTCTCGGGCCTGCTGACCAT
CGGTTCCCGCTTCGGCGGTGCCCTGGACGGCGCCGCCGACGAGTTCACCCGGGCCTTTGACAAGAACCTCAGCCC
GCGCGAGTTTGTCGATAGCATGCGCAAGGCCAACAAGCTCATCCCGGGCATCGGTCACCGCGTCAAGTCGCGCAA
CAACCCGGACCTCCGGGTCGAGCTGGTCAAGGAGTACGTCTTGGCCAAGTTCCCCAGCCACAAGCTCCTCGACTA
CGCCCTGGCCGTCGAGACGGTGACGACGTCCAAGAAGGACAACCTGATCCTCAACGTCGACGGTTGCATCGCCGT
CTGTTTCGTCGACCTGCTGCGCAACTGCGGCGCCTTTTCTGCCGAGGAGGCCGAGGACTACCTGCAGATGGGCGT
CCTCAACGGCCTGTTCGTGCTCGGCCGCAGCATCGGCCTCATCGCCCACTTCCTCGACCAGAAGAGGCTGCGGAC
CGGTCTGTACCGCCACCCGTGGGATGACATCACCTACCTGCTGCCCAACCTGCGAGAGGGACGGCCGGGCGCCGA
GGGCAGAGTCGAGGTGCAGATGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail