Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05763
Gene name
Locationscaffold_06:2193356..2194885
Strand-
Gene length (bp)1529
Transcript length (bp)1470
Coding sequence length (bp)1470
Protein length (aa) 490

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16114 Citrate_bind ATP citrate lyase citrate-binding 4.5E-87 298 474
PF08442 ATP-grasp_2 ATP-grasp domain 7.3E-08 73 228

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.7817 0.4142 0.0045 0.0369 0.2385 0.0573 0.0718 0.0539 0.1809 0.1251

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1553
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|30
Ophiocordyceps australis map64 (Brazil) OphauB2|1570
Ophiocordyceps camponoti-floridani Ophcf2|05763 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7344
Ophiocordyceps kimflemingae Ophio5|5972
Ophiocordyceps subramaniannii Hirsu2|1129

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05763
MSAKSILEADGKAILNYHLTRAPAIKPSPLPRPTKHNPPPRLASLHFPEDASVESVLNQAEITYPWLLQAGAKFV
AKPDQLIKRRGKSGLLALNKTWAEAKAWIAERAGKEQKVEHTTGVLRQFLVEPFVPHPQDTEYYININSVRDGDW
ILFTHEGGVDVGDVDAKAEKLLIPVDLSEYPSNEEIAAALLKKVPKGIHNVLVDFITRLYAVYVDCQFTYLEINP
LVVMPNDDKTSAAVHFLDLAAKLDQTADFECGVKWATARSPAALGLTNVAAVNGEKVNIDAGPPMEFPAPFGREL
SKEEAYIADLDAKTGASLKLTVLNPNGRIWTLVAGGGASVVYADAIASAGFADDLANYGEYSGAPTESQTYHYAR
TVLDLMLRAPMSDKGKVLFIGGGIANFTNVASTFKGVIRALRDHATQLIEHKVQIWVRRAGPNFQEGLKNMKAAT
QDMGLDAKIFGPEMHVSGIVPLALIPGRWEESEVEEFKG*
Coding >Ophcf2|05763
ATGTCAGCCAAGTCGATTCTCGAGGCCGACGGCAAGGCCATCCTCAACTACCATCTCACCCGGGCTCCAGCCATC
AAGCCCAGCCCGCTGCCACGGCCGACCAAGCATAATCCGCCCCCGAGGCTGGCCTCTCTGCACTTCCCCGAGGAT
GCCAGCGTCGAGAGCGTCCTCAACCAGGCCGAGATTACCTATCCCTGGCTCCTCCAGGCCGGGGCAAAGTTCGTC
GCCAAGCCGGACCAGCTCATCAAGCGACGAGGTAAGAGCGGTCTCCTGGCCCTCAACAAGACGTGGGCCGAGGCC
AAGGCCTGGATCGCCGAAAGAGCCGGTAAGGAGCAAAAGGTCGAGCACACGACGGGCGTCTTGAGACAATTCCTC
GTCGAGCCCTTTGTGCCTCACCCGCAGGACACGGAGTATTACATCAACATCAACTCCGTCCGCGATGGTGACTGG
ATCCTCTTTACCCACGAGGGCGGCGTCGACGTAGGCGATGTCGACGCAAAGGCAGAGAAGCTGCTCATCCCCGTC
GACCTCTCCGAGTATCCGTCCAACGAGGAGATTGCGGCCGCCCTACTCAAAAAGGTGCCCAAGGGCATCCACAAT
GTTCTCGTCGACTTCATCACTCGGCTCTACGCCGTCTACGTCGACTGCCAGTTTACCTATCTCGAGATCAACCCG
CTGGTGGTGATGCCCAACGACGACAAGACGTCGGCCGCTGTTCACTTCCTCGACCTGGCCGCCAAGCTGGATCAG
ACGGCCGACTTTGAGTGCGGCGTCAAGTGGGCGACGGCCCGCTCGCCCGCAGCTCTGGGCCTGACCAACGTGGCG
GCCGTCAACGGCGAAAAGGTCAACATCGACGCCGGCCCGCCCATGGAGTTTCCGGCCCCGTTCGGGCGCGAGCTC
TCCAAGGAGGAGGCTTACATCGCCGACCTCGACGCCAAGACGGGTGCCTCGCTCAAGCTGACGGTGCTCAACCCC
AACGGACGCATCTGGACGCTGGTGGCAGGCGGCGGCGCCTCGGTCGTCTACGCCGATGCCATCGCCTCGGCCGGC
TTCGCCGATGACCTGGCCAACTACGGCGAGTACTCGGGCGCCCCTACGGAGTCGCAGACGTACCACTACGCCCGG
ACCGTGCTGGACCTGATGCTCCGGGCTCCCATGTCGGACAAGGGCAAAGTGCTCTTCATCGGCGGCGGCATCGCC
AACTTCACCAACGTGGCCAGCACTTTCAAGGGCGTGATCCGGGCCCTGCGCGACCACGCGACGCAGCTGATTGAG
CACAAGGTGCAGATTTGGGTGCGTCGGGCCGGACCCAACTTCCAGGAGGGTCTGAAGAACATGAAGGCCGCCACG
CAGGACATGGGCCTCGACGCCAAGATCTTTGGGCCCGAGATGCACGTCTCGGGCATCGTGCCGCTGGCCCTGATT
CCCGGCAGGTGGGAGGAGAGCGAGGTGGAGGAGTTTAAGGGGTAG
Transcript >Ophcf2|05763
ATGTCAGCCAAGTCGATTCTCGAGGCCGACGGCAAGGCCATCCTCAACTACCATCTCACCCGGGCTCCAGCCATC
AAGCCCAGCCCGCTGCCACGGCCGACCAAGCATAATCCGCCCCCGAGGCTGGCCTCTCTGCACTTCCCCGAGGAT
GCCAGCGTCGAGAGCGTCCTCAACCAGGCCGAGATTACCTATCCCTGGCTCCTCCAGGCCGGGGCAAAGTTCGTC
GCCAAGCCGGACCAGCTCATCAAGCGACGAGGTAAGAGCGGTCTCCTGGCCCTCAACAAGACGTGGGCCGAGGCC
AAGGCCTGGATCGCCGAAAGAGCCGGTAAGGAGCAAAAGGTCGAGCACACGACGGGCGTCTTGAGACAATTCCTC
GTCGAGCCCTTTGTGCCTCACCCGCAGGACACGGAGTATTACATCAACATCAACTCCGTCCGCGATGGTGACTGG
ATCCTCTTTACCCACGAGGGCGGCGTCGACGTAGGCGATGTCGACGCAAAGGCAGAGAAGCTGCTCATCCCCGTC
GACCTCTCCGAGTATCCGTCCAACGAGGAGATTGCGGCCGCCCTACTCAAAAAGGTGCCCAAGGGCATCCACAAT
GTTCTCGTCGACTTCATCACTCGGCTCTACGCCGTCTACGTCGACTGCCAGTTTACCTATCTCGAGATCAACCCG
CTGGTGGTGATGCCCAACGACGACAAGACGTCGGCCGCTGTTCACTTCCTCGACCTGGCCGCCAAGCTGGATCAG
ACGGCCGACTTTGAGTGCGGCGTCAAGTGGGCGACGGCCCGCTCGCCCGCAGCTCTGGGCCTGACCAACGTGGCG
GCCGTCAACGGCGAAAAGGTCAACATCGACGCCGGCCCGCCCATGGAGTTTCCGGCCCCGTTCGGGCGCGAGCTC
TCCAAGGAGGAGGCTTACATCGCCGACCTCGACGCCAAGACGGGTGCCTCGCTCAAGCTGACGGTGCTCAACCCC
AACGGACGCATCTGGACGCTGGTGGCAGGCGGCGGCGCCTCGGTCGTCTACGCCGATGCCATCGCCTCGGCCGGC
TTCGCCGATGACCTGGCCAACTACGGCGAGTACTCGGGCGCCCCTACGGAGTCGCAGACGTACCACTACGCCCGG
ACCGTGCTGGACCTGATGCTCCGGGCTCCCATGTCGGACAAGGGCAAAGTGCTCTTCATCGGCGGCGGCATCGCC
AACTTCACCAACGTGGCCAGCACTTTCAAGGGCGTGATCCGGGCCCTGCGCGACCACGCGACGCAGCTGATTGAG
CACAAGGTGCAGATTTGGGTGCGTCGGGCCGGACCCAACTTCCAGGAGGGTCTGAAGAACATGAAGGCCGCCACG
CAGGACATGGGCCTCGACGCCAAGATCTTTGGGCCCGAGATGCACGTCTCGGGCATCGTGCCGCTGGCCCTGATT
CCCGGCAGGTGGGAGGAGAGCGAGGTGGAGGAGTTTAAGGGGTAG
Gene >Ophcf2|05763
ATGTCAGCCAAGTCGATTCTCGAGGCCGACGGCAAGGCCATCCTCAACTACCATCTCACCCGGGCTCCAGCCATC
AAGCCCAGCCCGCTGCCACGGCCGACCAAGCATAATCCGCCCCCGAGGCTGGCCTCTCTGCACTTCCCCGAGGAT
GCCAGCGTCGAGAGCGTCCTCAACCAGGCCGAGATTACCTATCCCTGGCTCCTCCAGGCCGGGGCAAAGTTCGTC
GCCAAGCCGGACCAGCTCATCAAGCGACGAGGTAAGAGCGGTCTCCTGGCCCTCAACAAGACGTGGGCCGAGGCC
AAGGCCTGGATCGCCGAAAGAGCCGGTAAGGAGCAAAAGGTCGAGCACACGACGGGCGTCTTGAGACAATTCCTC
GTCGAGCCCTTTGTGCCTCACCCGCAGGACACGGAGTATTACATCAACATCAACTCCGTCCGCGATGTGCGTGTT
CCCTGTATAATATGCAAATCCCGGCTGACGTCTTTTTCTTCTCTCACCAGGGTGACTGGATCCTCTTTACCCACG
AGGGCGGCGTCGACGTAGGCGATGTCGACGCAAAGGCAGAGAAGCTGCTCATCCCCGTCGACCTCTCCGAGTATC
CGTCCAACGAGGAGATTGCGGCCGCCCTACTCAAAAAGGTGCCCAAGGGCATCCACAATGTTCTCGTCGACTTCA
TCACTCGGCTCTACGCCGTCTACGTCGACTGCCAGTTTACCTATCTCGAGATCAACCCGCTGGTGGTGATGCCCA
ACGACGACAAGACGTCGGCCGCTGTTCACTTCCTCGACCTGGCCGCCAAGCTGGATCAGACGGCCGACTTTGAGT
GCGGCGTCAAGTGGGCGACGGCCCGCTCGCCCGCAGCTCTGGGCCTGACCAACGTGGCGGCCGTCAACGGCGAAA
AGGTCAACATCGACGCCGGCCCGCCCATGGAGTTTCCGGCCCCGTTCGGGCGCGAGCTCTCCAAGGAGGAGGCTT
ACATCGCCGACCTCGACGCCAAGACGGGTGCCTCGCTCAAGCTGACGGTGCTCAACCCCAACGGACGCATCTGGA
CGCTGGTGGCAGGCGGCGGCGCCTCGGTCGTCTACGCCGATGCCATCGCCTCGGCCGGCTTCGCCGATGACCTGG
CCAACTACGGCGAGTACTCGGGCGCCCCTACGGAGTCGCAGACGTACCACTACGCCCGGACCGTGCTGGACCTGA
TGCTCCGGGCTCCCATGTCGGACAAGGGCAAAGTGCTCTTCATCGGCGGCGGCATCGCCAACTTCACCAACGTGG
CCAGCACTTTCAAGGGCGTGATCCGGGCCCTGCGCGACCACGCGACGCAGCTGATTGAGCACAAGGTGCAGATTT
GGGTGCGTCGGGCCGGACCCAACTTCCAGGAGGGTCTGAAGAACATGAAGGCCGCCACGCAGGACATGGGCCTCG
ACGCCAAGATCTTTGGGCCCGAGATGCACGTCTCGGGCATCGTGCCGCTGGCCCTGATTCCCGGCAGGTGGGAGG
AGAGCGAGGTGGAGGAGTTTAAGGGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail