Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05755
Gene name
Locationscaffold_06:2179386..2181486
Strand-
Gene length (bp)2100
Transcript length (bp)2100
Coding sequence length (bp)2100
Protein length (aa) 700

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 8.6E-08 394 487
PF12796 Ank_2 Ankyrin repeats (3 copies) 5.3E-12 465 552
PF12796 Ank_2 Ankyrin repeats (3 copies) 9.5E-15 593 679
PF13606 Ank_3 Ankyrin repeat 7.1E-04 524 551
PF13606 Ank_3 Ankyrin repeat 8.4E-04 622 649
PF13637 Ank_4 Ankyrin repeats (many copies) 1.0E-06 492 544
PF13637 Ank_4 Ankyrin repeats (many copies) 6.2E-06 623 675
PF00023 Ank Ankyrin repeat 5.9E-04 525 554
PF00023 Ank Ankyrin repeat 1.6E-05 622 649
PF06985 HET Heterokaryon incompatibility protein (HET) 1.9E-10 22 104

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6052 0.4011 0.1134 0.3412 0.3476 0.1229 0.2112 0.2574 0.2806 0.1951

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup159
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2430
Ophiocordyceps australis map64 (Brazil) OphauB2|4370
Ophiocordyceps camponoti-floridani Ophcf2|05755 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1664
Ophiocordyceps kimflemingae Ophio5|2604
Ophiocordyceps subramaniannii Hirsu2|11144
Ophiocordyceps subramaniannii Hirsu2|1775
Ophiocordyceps subramaniannii Hirsu2|2149
Ophiocordyceps subramaniannii Hirsu2|8004
Ophiocordyceps subramaniannii Hirsu2|8316
Ophiocordyceps subramaniannii Hirsu2|955

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05755
MRLLRTDDLSVCEFAYGYVPIYAILSHRWGRDEVTLQDVQAQDGSKKGFTKIERCCARARQDGFRYVWIDTCCID
KTSSAELSEAINSMFVWYYRAGRCYVHLADVPYRSFGDSVWFTRGWTLQELLAPPECHFLDKNWAHIGTKTLLQQ
AISDCTGIPLEILSGEADMETASIAQKMSWAAKRETTRVEDGAYCLLGVFGINMPLIYGEGERAFFRLQEEIMKV
SDDHSLFAWEASDARGGLLATSPAAFLQCGSIVPFNPFDTPHEPWTVSSRGVYVDLRFVGCGRQGLGMAILHCKD
RNRGGRPLAIYLRDTTLTMERFRRVRSESLASVDMEKLRFCQCPIRRLCIQTQRITLIGEDDRREEDEGMGNLYE
AGEMSNMKLMDFGDPDVLLRAAEWGEEGLVWLLLTRSDVDVNRQGMASHTALSLAVEKENEAMVRMLLARSNIKT
DARYGAGWTLLPRAAALNNINIFRQLLNSDKVDINATGERLRSALTIAVVNGNETMIQLLLQRGVDMETKDSSNQ
TPLMHAILNKNETVVKLLLQTGADFEAIDSSNKTPLMHAVKTRDVALTRTLLEHAAKCKTEVKYPSSLLYAVRDE
QSVLASALLDHGADVDARNWTGDTPLMIAAELGDEAMVSLLLDHGANIEKKSWQGHTPLKIATRQGNEQVVRLLV
ERGAVTDWRFRLADKWSGFKKRTP*
Coding >Ophcf2|05755
ATGCGTCTTTTGAGAACTGACGACCTCTCAGTATGCGAGTTTGCCTACGGCTATGTCCCGATATACGCCATCCTG
TCCCACAGATGGGGCAGAGACGAGGTCACACTGCAGGACGTACAGGCTCAAGATGGAAGCAAAAAGGGATTCACC
AAGATAGAGCGGTGCTGTGCAAGAGCCAGACAGGATGGCTTCCGCTACGTCTGGATCGACACTTGCTGCATCGAC
AAGACCAGCAGCGCTGAGCTGTCAGAGGCCATCAACTCCATGTTCGTCTGGTACTACAGGGCCGGCAGATGCTAT
GTTCATCTCGCCGATGTGCCCTACAGGTCCTTTGGCGACAGCGTGTGGTTCACGAGAGGATGGACCTTGCAGGAG
CTTCTCGCTCCGCCGGAATGCCACTTTCTTGACAAGAATTGGGCTCATATCGGGACCAAAACACTGCTGCAACAG
GCCATCTCCGATTGCACCGGCATACCTCTCGAGATCCTATCGGGGGAAGCGGACATGGAGACGGCCAGCATAGCG
CAAAAGATGTCATGGGCGGCGAAAAGAGAAACGACTCGAGTCGAAGACGGAGCGTATTGTCTGCTGGGAGTCTTT
GGCATCAACATGCCGCTCATATACGGAGAAGGAGAGAGGGCCTTCTTCCGTCTACAGGAGGAGATAATGAAGGTT
TCCGACGATCACAGCCTCTTTGCCTGGGAAGCGTCTGACGCAAGAGGCGGACTGCTTGCCACATCTCCGGCAGCC
TTCCTACAATGTGGCAGCATCGTGCCCTTCAACCCCTTCGATACGCCTCACGAACCGTGGACGGTAAGCAGTAGG
GGCGTCTACGTCGATCTCCGGTTCGTGGGCTGCGGCAGACAGGGCCTCGGCATGGCCATCCTTCACTGCAAGGAT
AGAAACAGGGGGGGTAGACCGTTGGCCATCTATCTCAGGGATACGACCCTGACCATGGAGCGCTTCAGACGAGTG
CGGAGTGAAAGTCTGGCAAGTGTAGACATGGAAAAGTTGAGGTTCTGTCAGTGTCCTATCCGGAGGCTTTGCATT
CAGACTCAACGTATCACTCTCATCGGGGAGGACGACAGGAGAGAAGAGGACGAAGGCATGGGAAACTTGTACGAG
GCTGGAGAGATGTCCAACATGAAGCTCATGGACTTTGGGGACCCGGACGTGTTGCTGAGAGCGGCCGAATGGGGA
GAAGAAGGCCTGGTATGGCTGCTACTAACGAGGAGCGACGTCGACGTCAACCGCCAAGGAATGGCATCACATACG
GCTTTGTCTCTGGCGGTAGAGAAGGAGAACGAGGCCATGGTGAGGATGCTACTGGCCCGAAGCAACATCAAGACG
GACGCCCGGTACGGAGCTGGTTGGACCTTGCTGCCTCGAGCGGCTGCCTTGAACAACATCAACATATTCAGGCAG
CTCCTCAACTCGGACAAAGTCGACATTAACGCGACAGGAGAAAGGCTCAGATCTGCTCTGACCATTGCCGTCGTC
AACGGAAACGAGACAATGATTCAACTCTTACTGCAAAGAGGCGTCGATATGGAGACAAAGGACTCTTCTAACCAA
ACGCCCCTTATGCACGCCATCCTCAACAAAAACGAAACCGTGGTTAAACTCCTGCTTCAAACAGGCGCCGACTTC
GAGGCAATAGACTCTTCTAACAAGACGCCCCTTATGCACGCCGTCAAAACCAGAGACGTCGCCTTGACCCGAACG
CTACTCGAACACGCAGCCAAGTGCAAGACAGAAGTCAAATATCCTTCATCCCTTCTCTACGCCGTGAGAGACGAA
CAGAGTGTGCTCGCCAGCGCGCTACTCGACCACGGCGCCGACGTAGACGCCAGGAACTGGACAGGAGACACGCCG
CTGATGATTGCCGCCGAGTTGGGCGACGAGGCCATGGTCAGCTTATTGCTAGACCACGGGGCGAATATAGAGAAG
AAGTCGTGGCAGGGTCATACGCCGCTGAAAATCGCCACTCGTCAGGGGAATGAACAGGTTGTCAGGCTGTTGGTT
GAGAGGGGCGCCGTGACTGACTGGAGGTTTCGCTTGGCTGATAAGTGGTCTGGCTTCAAGAAGCGGACGCCGTAG
Transcript >Ophcf2|05755
ATGCGTCTTTTGAGAACTGACGACCTCTCAGTATGCGAGTTTGCCTACGGCTATGTCCCGATATACGCCATCCTG
TCCCACAGATGGGGCAGAGACGAGGTCACACTGCAGGACGTACAGGCTCAAGATGGAAGCAAAAAGGGATTCACC
AAGATAGAGCGGTGCTGTGCAAGAGCCAGACAGGATGGCTTCCGCTACGTCTGGATCGACACTTGCTGCATCGAC
AAGACCAGCAGCGCTGAGCTGTCAGAGGCCATCAACTCCATGTTCGTCTGGTACTACAGGGCCGGCAGATGCTAT
GTTCATCTCGCCGATGTGCCCTACAGGTCCTTTGGCGACAGCGTGTGGTTCACGAGAGGATGGACCTTGCAGGAG
CTTCTCGCTCCGCCGGAATGCCACTTTCTTGACAAGAATTGGGCTCATATCGGGACCAAAACACTGCTGCAACAG
GCCATCTCCGATTGCACCGGCATACCTCTCGAGATCCTATCGGGGGAAGCGGACATGGAGACGGCCAGCATAGCG
CAAAAGATGTCATGGGCGGCGAAAAGAGAAACGACTCGAGTCGAAGACGGAGCGTATTGTCTGCTGGGAGTCTTT
GGCATCAACATGCCGCTCATATACGGAGAAGGAGAGAGGGCCTTCTTCCGTCTACAGGAGGAGATAATGAAGGTT
TCCGACGATCACAGCCTCTTTGCCTGGGAAGCGTCTGACGCAAGAGGCGGACTGCTTGCCACATCTCCGGCAGCC
TTCCTACAATGTGGCAGCATCGTGCCCTTCAACCCCTTCGATACGCCTCACGAACCGTGGACGGTAAGCAGTAGG
GGCGTCTACGTCGATCTCCGGTTCGTGGGCTGCGGCAGACAGGGCCTCGGCATGGCCATCCTTCACTGCAAGGAT
AGAAACAGGGGGGGTAGACCGTTGGCCATCTATCTCAGGGATACGACCCTGACCATGGAGCGCTTCAGACGAGTG
CGGAGTGAAAGTCTGGCAAGTGTAGACATGGAAAAGTTGAGGTTCTGTCAGTGTCCTATCCGGAGGCTTTGCATT
CAGACTCAACGTATCACTCTCATCGGGGAGGACGACAGGAGAGAAGAGGACGAAGGCATGGGAAACTTGTACGAG
GCTGGAGAGATGTCCAACATGAAGCTCATGGACTTTGGGGACCCGGACGTGTTGCTGAGAGCGGCCGAATGGGGA
GAAGAAGGCCTGGTATGGCTGCTACTAACGAGGAGCGACGTCGACGTCAACCGCCAAGGAATGGCATCACATACG
GCTTTGTCTCTGGCGGTAGAGAAGGAGAACGAGGCCATGGTGAGGATGCTACTGGCCCGAAGCAACATCAAGACG
GACGCCCGGTACGGAGCTGGTTGGACCTTGCTGCCTCGAGCGGCTGCCTTGAACAACATCAACATATTCAGGCAG
CTCCTCAACTCGGACAAAGTCGACATTAACGCGACAGGAGAAAGGCTCAGATCTGCTCTGACCATTGCCGTCGTC
AACGGAAACGAGACAATGATTCAACTCTTACTGCAAAGAGGCGTCGATATGGAGACAAAGGACTCTTCTAACCAA
ACGCCCCTTATGCACGCCATCCTCAACAAAAACGAAACCGTGGTTAAACTCCTGCTTCAAACAGGCGCCGACTTC
GAGGCAATAGACTCTTCTAACAAGACGCCCCTTATGCACGCCGTCAAAACCAGAGACGTCGCCTTGACCCGAACG
CTACTCGAACACGCAGCCAAGTGCAAGACAGAAGTCAAATATCCTTCATCCCTTCTCTACGCCGTGAGAGACGAA
CAGAGTGTGCTCGCCAGCGCGCTACTCGACCACGGCGCCGACGTAGACGCCAGGAACTGGACAGGAGACACGCCG
CTGATGATTGCCGCCGAGTTGGGCGACGAGGCCATGGTCAGCTTATTGCTAGACCACGGGGCGAATATAGAGAAG
AAGTCGTGGCAGGGTCATACGCCGCTGAAAATCGCCACTCGTCAGGGGAATGAACAGGTTGTCAGGCTGTTGGTT
GAGAGGGGCGCCGTGACTGACTGGAGGTTTCGCTTGGCTGATAAGTGGTCTGGCTTCAAGAAGCGGACGCCGTAG
Gene >Ophcf2|05755
ATGCGTCTTTTGAGAACTGACGACCTCTCAGTATGCGAGTTTGCCTACGGCTATGTCCCGATATACGCCATCCTG
TCCCACAGATGGGGCAGAGACGAGGTCACACTGCAGGACGTACAGGCTCAAGATGGAAGCAAAAAGGGATTCACC
AAGATAGAGCGGTGCTGTGCAAGAGCCAGACAGGATGGCTTCCGCTACGTCTGGATCGACACTTGCTGCATCGAC
AAGACCAGCAGCGCTGAGCTGTCAGAGGCCATCAACTCCATGTTCGTCTGGTACTACAGGGCCGGCAGATGCTAT
GTTCATCTCGCCGATGTGCCCTACAGGTCCTTTGGCGACAGCGTGTGGTTCACGAGAGGATGGACCTTGCAGGAG
CTTCTCGCTCCGCCGGAATGCCACTTTCTTGACAAGAATTGGGCTCATATCGGGACCAAAACACTGCTGCAACAG
GCCATCTCCGATTGCACCGGCATACCTCTCGAGATCCTATCGGGGGAAGCGGACATGGAGACGGCCAGCATAGCG
CAAAAGATGTCATGGGCGGCGAAAAGAGAAACGACTCGAGTCGAAGACGGAGCGTATTGTCTGCTGGGAGTCTTT
GGCATCAACATGCCGCTCATATACGGAGAAGGAGAGAGGGCCTTCTTCCGTCTACAGGAGGAGATAATGAAGGTT
TCCGACGATCACAGCCTCTTTGCCTGGGAAGCGTCTGACGCAAGAGGCGGACTGCTTGCCACATCTCCGGCAGCC
TTCCTACAATGTGGCAGCATCGTGCCCTTCAACCCCTTCGATACGCCTCACGAACCGTGGACGGTAAGCAGTAGG
GGCGTCTACGTCGATCTCCGGTTCGTGGGCTGCGGCAGACAGGGCCTCGGCATGGCCATCCTTCACTGCAAGGAT
AGAAACAGGGGGGGTAGACCGTTGGCCATCTATCTCAGGGATACGACCCTGACCATGGAGCGCTTCAGACGAGTG
CGGAGTGAAAGTCTGGCAAGTGTAGACATGGAAAAGTTGAGGTTCTGTCAGTGTCCTATCCGGAGGCTTTGCATT
CAGACTCAACGTATCACTCTCATCGGGGAGGACGACAGGAGAGAAGAGGACGAAGGCATGGGAAACTTGTACGAG
GCTGGAGAGATGTCCAACATGAAGCTCATGGACTTTGGGGACCCGGACGTGTTGCTGAGAGCGGCCGAATGGGGA
GAAGAAGGCCTGGTATGGCTGCTACTAACGAGGAGCGACGTCGACGTCAACCGCCAAGGAATGGCATCACATACG
GCTTTGTCTCTGGCGGTAGAGAAGGAGAACGAGGCCATGGTGAGGATGCTACTGGCCCGAAGCAACATCAAGACG
GACGCCCGGTACGGAGCTGGTTGGACCTTGCTGCCTCGAGCGGCTGCCTTGAACAACATCAACATATTCAGGCAG
CTCCTCAACTCGGACAAAGTCGACATTAACGCGACAGGAGAAAGGCTCAGATCTGCTCTGACCATTGCCGTCGTC
AACGGAAACGAGACAATGATTCAACTCTTACTGCAAAGAGGCGTCGATATGGAGACAAAGGACTCTTCTAACCAA
ACGCCCCTTATGCACGCCATCCTCAACAAAAACGAAACCGTGGTTAAACTCCTGCTTCAAACAGGCGCCGACTTC
GAGGCAATAGACTCTTCTAACAAGACGCCCCTTATGCACGCCGTCAAAACCAGAGACGTCGCCTTGACCCGAACG
CTACTCGAACACGCAGCCAAGTGCAAGACAGAAGTCAAATATCCTTCATCCCTTCTCTACGCCGTGAGAGACGAA
CAGAGTGTGCTCGCCAGCGCGCTACTCGACCACGGCGCCGACGTAGACGCCAGGAACTGGACAGGAGACACGCCG
CTGATGATTGCCGCCGAGTTGGGCGACGAGGCCATGGTCAGCTTATTGCTAGACCACGGGGCGAATATAGAGAAG
AAGTCGTGGCAGGGTCATACGCCGCTGAAAATCGCCACTCGTCAGGGGAATGAACAGGTTGTCAGGCTGTTGGTT
GAGAGGGGCGCCGTGACTGACTGGAGGTTTCGCTTGGCTGATAAGTGGTCTGGCTTCAAGAAGCGGACGCCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail