Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05752
Gene name
Locationscaffold_06:2174582..2175885
Strand+
Gene length (bp)1303
Transcript length (bp)1101
Coding sequence length (bp)1101
Protein length (aa) 367

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10343 Q_salvage Potential Queuosine, Q, salvage protein family 2.2E-125 79 366

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.649 0.5236 0.1206 0.1615 0.2277 0.0446 0.074 0.1877 0.0829 0.0023

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3593
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|37
Ophiocordyceps australis map64 (Brazil) OphauB2|1578
Ophiocordyceps camponoti-floridani Ophcf2|05752 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1668
Ophiocordyceps kimflemingae Ophio5|6230
Ophiocordyceps subramaniannii Hirsu2|6925

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05752
MSDDEPDPELLALLRQKLIGQPVQTDEPEMGVLEGAHYVYDNGYDVAIDMRSTKRAAESILLQMQRKAYSAATWS
EHELHPKTKDEATVAFIFTMDLLNFSFWSELPDDERFAVEYRGRIWKGYWSLVAALQRALDDGVPMTDPHFWQNE
DECNMESMRRVFRSCTDEEMPMLQERLDCLRECGRVLYERYNCSFTDVISAAAGSAPRLVNILARDFPCFRDEHS
FTGRIKPVRFLKRAQILVADLWACFQGTSYGKFRDIDKITVFADYRVPQILISLGALYCCPPLVAAIKDRRPLES
GGSWEVQLRACSIWCVELMRKEMVRLHPKTHINAILIDFFLYDTMQELEAEGQEALPHHRTRSIWY*
Coding >Ophcf2|05752
ATGTCCGACGACGAGCCCGATCCCGAGCTTCTCGCTCTCCTCCGTCAGAAGCTCATCGGTCAGCCCGTGCAAACC
GACGAGCCGGAAATGGGCGTCCTCGAGGGCGCCCATTACGTCTACGACAATGGCTACGACGTCGCCATCGATATG
CGCTCTACCAAGCGCGCCGCAGAGTCCATCCTTCTTCAGATGCAGCGCAAGGCTTACTCGGCTGCCACCTGGTCC
GAGCACGAGCTGCATCCCAAGACCAAGGACGAGGCTACCGTCGCCTTCATCTTCACCATGGACCTTCTCAACTTT
TCCTTCTGGTCTGAGCTTCCGGACGATGAGAGATTCGCTGTCGAGTATCGCGGGAGGATCTGGAAGGGTTACTGG
AGTCTCGTTGCTGCTCTTCAGCGTGCCCTCGACGACGGCGTCCCCATGACCGATCCGCACTTCTGGCAGAACGAG
GACGAGTGCAACATGGAATCCATGCGACGCGTCTTCAGGTCTTGCACAGACGAGGAGATGCCAATGTTACAGGAG
CGCCTGGACTGTCTCCGAGAATGCGGCCGTGTCCTCTACGAGCGCTACAACTGCTCCTTCACCGACGTCATCTCC
GCCGCCGCCGGCTCCGCCCCTCGTCTCGTCAATATCCTGGCCCGCGACTTTCCCTGCTTCCGCGACGAGCACAGC
TTCACAGGCAGGATCAAACCCGTCAGATTCCTCAAGCGCGCACAGATCCTCGTCGCCGATCTGTGGGCCTGTTTC
CAGGGCACCTCGTACGGCAAGTTCCGCGACATTGACAAAATCACCGTCTTCGCCGACTATCGCGTACCCCAGATT
CTCATCAGCCTGGGTGCCCTGTACTGCTGCCCGCCTCTGGTCGCTGCCATCAAGGACCGGCGCCCGCTTGAGAGC
GGAGGCAGCTGGGAGGTGCAGCTGAGAGCGTGCAGCATCTGGTGTGTCGAGCTCATGCGTAAGGAAATGGTGAGG
CTGCATCCCAAGACGCACATCAACGCCATCTTGATAGACTTCTTTCTCTACGATACCATGCAAGAATTAGAGGCT
GAGGGCCAGGAGGCTCTGCCCCACCACAGAACGAGGAGTATCTGGTACTAG
Transcript >Ophcf2|05752
ATGTCCGACGACGAGCCCGATCCCGAGCTTCTCGCTCTCCTCCGTCAGAAGCTCATCGGTCAGCCCGTGCAAACC
GACGAGCCGGAAATGGGCGTCCTCGAGGGCGCCCATTACGTCTACGACAATGGCTACGACGTCGCCATCGATATG
CGCTCTACCAAGCGCGCCGCAGAGTCCATCCTTCTTCAGATGCAGCGCAAGGCTTACTCGGCTGCCACCTGGTCC
GAGCACGAGCTGCATCCCAAGACCAAGGACGAGGCTACCGTCGCCTTCATCTTCACCATGGACCTTCTCAACTTT
TCCTTCTGGTCTGAGCTTCCGGACGATGAGAGATTCGCTGTCGAGTATCGCGGGAGGATCTGGAAGGGTTACTGG
AGTCTCGTTGCTGCTCTTCAGCGTGCCCTCGACGACGGCGTCCCCATGACCGATCCGCACTTCTGGCAGAACGAG
GACGAGTGCAACATGGAATCCATGCGACGCGTCTTCAGGTCTTGCACAGACGAGGAGATGCCAATGTTACAGGAG
CGCCTGGACTGTCTCCGAGAATGCGGCCGTGTCCTCTACGAGCGCTACAACTGCTCCTTCACCGACGTCATCTCC
GCCGCCGCCGGCTCCGCCCCTCGTCTCGTCAATATCCTGGCCCGCGACTTTCCCTGCTTCCGCGACGAGCACAGC
TTCACAGGCAGGATCAAACCCGTCAGATTCCTCAAGCGCGCACAGATCCTCGTCGCCGATCTGTGGGCCTGTTTC
CAGGGCACCTCGTACGGCAAGTTCCGCGACATTGACAAAATCACCGTCTTCGCCGACTATCGCGTACCCCAGATT
CTCATCAGCCTGGGTGCCCTGTACTGCTGCCCGCCTCTGGTCGCTGCCATCAAGGACCGGCGCCCGCTTGAGAGC
GGAGGCAGCTGGGAGGTGCAGCTGAGAGCGTGCAGCATCTGGTGTGTCGAGCTCATGCGTAAGGAAATGGTGAGG
CTGCATCCCAAGACGCACATCAACGCCATCTTGATAGACTTCTTTCTCTACGATACCATGCAAGAATTAGAGGCT
GAGGGCCAGGAGGCTCTGCCCCACCACAGAACGAGGAGTATCTGGTACTAG
Gene >Ophcf2|05752
ATGTCCGACGACGAGCCCGATCCCGAGCTTCTCGCTCTCCTCCGTCAGAAGCTCATCGGTCAGCCCGTGCAAACC
GACGAGCCGGAAATGGGCGTCCTCGAGGGCGCCCATTACGTCTACGACAATGGCTACGACGTCGCCATCGATATG
CGCTCTACCAAGCGCGCCGCAGAGTCCATCCTTCTTCAGATGCAGCGCAAGGCTTACTCGGCTGCCACCTGGTCC
GAGCACGAGCTGCATCCCAAGACCAAGGACGAGGCTACCGTCGCCTTCATCTTCACCATGGACCTTCTCAACTTT
TCCTTCTGGTCTGAGCTTCCGGACGATGAGAGATTCGCTGTCGAGTATCGCGGGAGGATCTGGAAGGGTTACTGG
AGTCTCGTTGCTGCTCTTCAGCGTGCCCTCGACGACGGTCAGTCTACGCATACATACTCTTCACATACACATACT
ACAATGTCCCCCGGAGCCTGAGACCGTCGTCTGACGCCCGCTTCCATCAAAAGGCGTCCCCATGACCGATCCGCA
CTTCTGGCAGAACGAGGACGAGTGCAACATGGAATCCATGCGACGCGTCTTCAGGTCTTGCACAGACGAGGAGAT
GCCAATGTTACAGGAGCGCCTGGACTGTCTCCGAGAATGCGGCCGTGTCCTCTACGAGGTGATTTCTCTTCAGCT
GCTCGTCCCCGTCCACTCCCGGCTCCTAACCCGTGACGAAGCGCTACAACTGCTCCTTCACCGACGTCATCTCCG
CCGCCGCCGGCTCCGCCCCTCGTCTCGTCAATATCCTGGCCCGCGACTTTCCCTGCTTCCGCGACGAGCACAGCT
TCACAGGCAGGATCAAACCCGTCAGATTCCTCAAGCGCGCACAGATCCTCGTCGCCGATCTGTGGGCCTGTTTCC
AGGGCACCTCGTACGGCAAGTTCCGCGACATTGACAAAATCACCGTCTTCGCCGACTATCGCGTACCCCAGATTC
TCATCAGCCTGGGTGCCCTGTACTGCTGCCCGCCTCTGGTCGCTGCCATCAAGGACCGGCGCCCGCTTGAGAGCG
GAGGCAGCTGGGAGGTGCAGCTGAGAGGTCAGTCGGCTTCCGTTGTTGGTGCTCGTGCTTCTCGTTCTGACGGCT
TGCAGCGTGCAGCATCTGGTGTGTCGAGCTCATGCGTAAGGAAATGGTGAGGCTGCATCCCAAGACGCACATCAA
CGCCATCTTGATAGACTTCTTTCTCTACGATACCATGCAAGAATTAGAGGCTGAGGGCCAGGAGGCTCTGCCCCA
CCACAGAACGAGGAGTATCTGGTACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail