Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05747
Gene name
Locationscaffold_06:2163868..2165179
Strand-
Gene length (bp)1311
Transcript length (bp)1176
Coding sequence length (bp)1176
Protein length (aa) 392

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00004 AAA ATPase family associated with various cellular activities (AAA) 4.8E-15 77 208
PF08542 Rep_fac_C Replication factor C C-terminal domain 3.5E-13 294 380
PF13177 DNA_pol3_delta2 DNA polymerase III, delta subunit 9.9E-09 60 210
PF03215 Rad17 Rad17 P-loop domain 1.4E-07 40 99

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016887 ATP hydrolysis activity Yes
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:1901265 nucleoside phosphate binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0003824 catalytic activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0016462 pyrophosphatase activity No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0030554 adenyl nucleotide binding No
GO:0097367 carbohydrate derivative binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3397 0.8459 0.0571 0.0122 0.1531 0.0055 0.0482 0.0662 0.0587 0.02

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6078
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|44
Ophiocordyceps australis map64 (Brazil) OphauB2|1584
Ophiocordyceps camponoti-floridani Ophcf2|05747 (this protein)
Ophiocordyceps kimflemingae Ophio5|2081
Ophiocordyceps subramaniannii Hirsu2|288

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05747
MDDDMDVDDGPAPSNDIVFSSDANKGKRTAANLPVEAEDSLPWVEKYRPTTLDQVSGHGDILATINKFVDSNRLP
HLLLYGPPGTGKTSTILALARRIYGTANMRQMVLELNASDDRGIDVVREQIKTFASTKQIFAMGGGSGGGRSSAA
GFKLIILDEADAMTNTAQMALRRIMEKYTANTRFCIIANYSHKLSPALLSRCTRFRFSPLSEADIRVLVDRVVEE
EKVKIGGEAVDALVGLSKGDMRRALNVLQACHASSTPLRSKTAPKPAADVEAGRETITTETIYNCIAAPPPDAIK
QITATLLETTDVTSCLTTVNSLKATRGLALADIITALAEQLNRLEVKAEVRICWLDALAEIEHRVAGGGNETVQT
GAVVGAVRNGVELMGR*
Coding >Ophcf2|05747
ATGGATGACGATATGGATGTCGACGACGGGCCTGCGCCTTCCAATGACATAGTATTTTCGTCCGATGCGAACAAG
GGGAAGCGTACGGCTGCCAATCTCCCCGTCGAGGCTGAGGATAGCCTGCCATGGGTGGAGAAATACCGACCGACG
ACGCTGGATCAGGTATCGGGTCACGGCGATATCCTGGCGACCATTAATAAGTTTGTCGACTCGAATCGGCTGCCT
CATCTGCTTCTCTACGGACCGCCTGGGACGGGCAAGACGTCGACGATACTGGCGCTCGCGCGGCGCATCTACGGC
ACGGCCAATATGCGACAGATGGTTCTCGAGCTCAACGCGTCCGACGACCGTGGCATTGACGTGGTACGCGAGCAA
ATCAAGACGTTTGCCAGCACCAAGCAGATCTTCGCCATGGGAGGAGGTTCGGGAGGTGGTCGGTCCTCGGCAGCC
GGCTTCAAACTCATCATCCTCGACGAGGCCGACGCCATGACCAACACGGCGCAGATGGCGTTGCGGCGCATCATG
GAAAAGTACACGGCCAACACGAGATTCTGCATCATCGCAAACTACTCGCACAAGCTGAGTCCCGCGCTGCTGAGC
CGCTGTACGCGCTTCCGCTTCAGCCCCCTGTCCGAGGCGGATATTCGCGTCTTGGTCGACAGGGTGGTGGAGGAG
GAAAAGGTCAAGATCGGGGGGGAGGCTGTCGATGCCCTCGTCGGGCTGAGTAAGGGGGATATGAGGAGGGCGTTG
AACGTGCTGCAGGCTTGCCACGCGTCGAGCACCCCCCTACGATCCAAGACGGCGCCCAAACCGGCAGCGGACGTC
GAGGCAGGGCGGGAGACGATCACGACGGAGACCATCTACAACTGCATCGCGGCGCCACCGCCCGACGCCATCAAG
CAAATCACGGCGACGCTCCTGGAGACGACGGACGTGACGAGCTGCCTGACGACGGTCAACTCGCTCAAGGCGACG
CGGGGGCTCGCCCTGGCGGATATCATCACGGCCTTGGCGGAGCAGCTGAATCGGCTCGAGGTCAAGGCCGAGGTG
CGCATCTGCTGGTTAGATGCGCTGGCCGAGATTGAGCACCGCGTCGCGGGAGGGGGGAATGAGACGGTTCAGACG
GGGGCTGTGGTGGGAGCTGTGCGGAACGGGGTTGAGCTGATGGGTCGGTAG
Transcript >Ophcf2|05747
ATGGATGACGATATGGATGTCGACGACGGGCCTGCGCCTTCCAATGACATAGTATTTTCGTCCGATGCGAACAAG
GGGAAGCGTACGGCTGCCAATCTCCCCGTCGAGGCTGAGGATAGCCTGCCATGGGTGGAGAAATACCGACCGACG
ACGCTGGATCAGGTATCGGGTCACGGCGATATCCTGGCGACCATTAATAAGTTTGTCGACTCGAATCGGCTGCCT
CATCTGCTTCTCTACGGACCGCCTGGGACGGGCAAGACGTCGACGATACTGGCGCTCGCGCGGCGCATCTACGGC
ACGGCCAATATGCGACAGATGGTTCTCGAGCTCAACGCGTCCGACGACCGTGGCATTGACGTGGTACGCGAGCAA
ATCAAGACGTTTGCCAGCACCAAGCAGATCTTCGCCATGGGAGGAGGTTCGGGAGGTGGTCGGTCCTCGGCAGCC
GGCTTCAAACTCATCATCCTCGACGAGGCCGACGCCATGACCAACACGGCGCAGATGGCGTTGCGGCGCATCATG
GAAAAGTACACGGCCAACACGAGATTCTGCATCATCGCAAACTACTCGCACAAGCTGAGTCCCGCGCTGCTGAGC
CGCTGTACGCGCTTCCGCTTCAGCCCCCTGTCCGAGGCGGATATTCGCGTCTTGGTCGACAGGGTGGTGGAGGAG
GAAAAGGTCAAGATCGGGGGGGAGGCTGTCGATGCCCTCGTCGGGCTGAGTAAGGGGGATATGAGGAGGGCGTTG
AACGTGCTGCAGGCTTGCCACGCGTCGAGCACCCCCCTACGATCCAAGACGGCGCCCAAACCGGCAGCGGACGTC
GAGGCAGGGCGGGAGACGATCACGACGGAGACCATCTACAACTGCATCGCGGCGCCACCGCCCGACGCCATCAAG
CAAATCACGGCGACGCTCCTGGAGACGACGGACGTGACGAGCTGCCTGACGACGGTCAACTCGCTCAAGGCGACG
CGGGGGCTCGCCCTGGCGGATATCATCACGGCCTTGGCGGAGCAGCTGAATCGGCTCGAGGTCAAGGCCGAGGTG
CGCATCTGCTGGTTAGATGCGCTGGCCGAGATTGAGCACCGCGTCGCGGGAGGGGGGAATGAGACGGTTCAGACG
GGGGCTGTGGTGGGAGCTGTGCGGAACGGGGTTGAGCTGATGGGTCGGTAG
Gene >Ophcf2|05747
ATGGATGACGATATGGATGTCGACGACGGGCCTGCGCCTTCCAATGACATAGTATTTTCGTCCGATGCGAACAAG
GGGAAGCGTACGGCTGCCAATCTCCCCGTCGAGGCTGAGGATAGCCTGCCATGGTTCGTCGTTCCTCGCACGCTT
CTTCTTGTCATCTATCCTCCCCGAGACTGAGTTACTGGCTGGTTGTGTAGGGTGGAGAAATACCGACCGACGACG
CTGGATCAGGTATCGGGTCACGGCGATATCCTGGCGACCATTAATAAGTTTGTCGACTCGAATCGGCTGCCTCAT
CTGCTTCTCTACGGACCGCCTGGGACGGGCAAGACGTCGACGATACTGGCGCTCGCGCGGCGCATCTACGGCACG
GCCAATATGCGACAGATGGTTCTCGAGCTCAACGCGTCCGACGACCGTGGCATTGACGTGGTACGCGAGCAAATC
AAGACGTTTGCCAGCACCAAGCAGATCTTCGCCATGGGAGGAGGTTCGGGAGGTGGTCGGTCCTCGGCAGCCGGC
TTCAAACTCATCATCCTCGACGAGGCCGACGCCATGACCAACACGGCGCAGATGGCGTTGCGGCGCATCATGGAA
AAGTACACGGCCAACACGAGATTCTGCATCATCGCAAACTACTCGCACAAGCTGAGTCCCGCGCTGCTGAGCCGC
TGTACGCGCTTCCGCTTCAGCCCCCTGTCCGAGGCGGATATTCGCGTCTTGGTCGACAGGGTGGTGGAGGAGGAA
AAGGTCAAGATCGGGGGGGAGGCTGTCGATGCCCTCGTCGGGCTGAGTAAGGGGGATATGAGGAGGGCGTTGAAC
GTGCTGCAGGCTTGCCACGCGTCGAGTGGGTTCCCACCCCGTCCACTGATGTTCAGCAGCGACTGACTAGACCTC
TCCCCCTTCCCAGGCACCCCCCTACGATCCAAGACGGCGCCCAAACCGGCAGCGGACGTCGAGGCAGGGCGGGAG
ACGATCACGACGGAGACCATCTACAACTGCATCGCGGCGCCACCGCCCGACGCCATCAAGCAAATCACGGCGACG
CTCCTGGAGACGACGGACGTGACGAGCTGCCTGACGACGGTCAACTCGCTCAAGGCGACGCGGGGGCTCGCCCTG
GCGGATATCATCACGGCCTTGGCGGAGCAGCTGAATCGGCTCGAGGTCAAGGCCGAGGTGCGCATCTGCTGGTTA
GATGCGCTGGCCGAGATTGAGCACCGCGTCGCGGGAGGGGGGAATGAGACGGTTCAGACGGGGGCTGTGGTGGGA
GCTGTGCGGAACGGGGTTGAGCTGATGGGTCGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail