Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05746
Gene name
Locationscaffold_06:2162105..2163565
Strand-
Gene length (bp)1460
Transcript length (bp)1260
Coding sequence length (bp)1260
Protein length (aa) 420

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4076 0.9387 0.0984 0.0528 0.1161 0.0008 0.0737 0.0441 0.0254 0.0162

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5065
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|45
Ophiocordyceps australis map64 (Brazil) OphauB2|1585
Ophiocordyceps camponoti-floridani Ophcf2|05746 (this protein)
Ophiocordyceps kimflemingae Ophio5|2083
Ophiocordyceps subramaniannii Hirsu2|286

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05746
MASTSPSDAHDLTPAGPHQTLPPNHLFAIQVGHQMFKLSGASLSSDSPSYFTRHFSQATDVHRPLYIDRDPDTFR
DMELHLQGYHVSARDGTHLVRLLSDARFYSLAKLTSQLYEADVFVSVGGREFRLSRRLLTSPTNSPNFFSLFISG
VDRGRDNDGDGDGGDDDDDDDDDDDGGGGGTGADMVMPGPSLPNRSAETFAELVRLLCGYRPRQWDETLRRDLLQ
DARYFGFKGVEQMLIPHALSYNPVLVRHEICILLDNVQKSGVSISPQAQQHQGETIAWVQYARPLIDDAPADLIV
EMGSDSTRLLWGSDGPRADFSGETRARVAKLLSVLAGKMSLPPTTQPLGLLMASGGASSQPPTPGNTPLSADLVR
VSMTRDTAVVLDGTCLVVGGETGGDDEGGSRKRRRVTRGGRFGS*
Coding >Ophcf2|05746
ATGGCTTCGACGAGCCCAAGTGATGCTCACGACTTGACGCCTGCCGGGCCTCATCAGACGCTGCCTCCCAATCAC
CTGTTCGCCATCCAGGTCGGGCACCAGATGTTCAAGTTATCAGGCGCCTCACTATCGTCCGACTCTCCGTCGTAC
TTTACACGACACTTCTCGCAAGCGACCGACGTCCATCGCCCGCTCTACATCGACCGCGACCCGGACACGTTCCGT
GACATGGAGCTTCATCTTCAAGGCTACCACGTCAGCGCCAGGGATGGAACGCACCTGGTGCGGCTCTTATCCGAT
GCGCGTTTCTACAGCCTCGCGAAGCTCACGTCGCAGCTCTACGAAGCAGACGTCTTCGTCTCCGTCGGCGGACGC
GAGTTTCGACTATCGCGCCGTCTGCTCACCAGTCCCACCAACTCGCCCAACTTCTTCTCGCTCTTTATCTCCGGC
GTTGACCGAGGCCGTGACAACGATGGCGATGGCGACGGCGGCGACGACGACGACGACGACGACGACGACGACGAC
GGTGGTGGTGGTGGTACAGGTGCCGACATGGTGATGCCCGGACCGTCGCTGCCGAATCGCTCGGCCGAGACGTTT
GCCGAGTTGGTCCGCTTGCTGTGCGGTTATCGTCCTCGTCAGTGGGATGAGACGCTGAGGAGGGATCTGTTGCAG
GACGCGCGGTACTTTGGCTTCAAGGGCGTTGAGCAGATGCTGATTCCGCATGCCTTGAGCTACAATCCCGTTCTC
GTCAGGCACGAGATTTGCATTCTACTTGATAACGTGCAGAAGAGCGGCGTCAGCATCTCTCCTCAAGCACAGCAG
CATCAAGGCGAGACGATAGCCTGGGTGCAATACGCGCGTCCGCTCATCGACGACGCACCTGCAGACCTCATCGTC
GAGATGGGCTCCGACTCGACGCGCCTCCTCTGGGGCTCCGACGGTCCCCGCGCGGATTTCTCGGGCGAAACACGC
GCCCGCGTCGCCAAACTCCTCTCCGTACTGGCCGGGAAGATGAGCCTCCCTCCCACAACGCAACCCCTAGGCCTC
CTGATGGCCTCGGGCGGCGCATCCTCGCAGCCCCCTACGCCGGGCAACACGCCCCTGAGCGCAGACCTAGTCCGC
GTCTCCATGACGCGCGACACGGCCGTCGTCCTGGACGGGACATGTCTGGTCGTCGGGGGGGAGACGGGCGGTGAT
GACGAGGGGGGTTCGCGGAAGAGGAGGCGGGTCACGCGCGGGGGGAGGTTTGGTTCGTGA
Transcript >Ophcf2|05746
ATGGCTTCGACGAGCCCAAGTGATGCTCACGACTTGACGCCTGCCGGGCCTCATCAGACGCTGCCTCCCAATCAC
CTGTTCGCCATCCAGGTCGGGCACCAGATGTTCAAGTTATCAGGCGCCTCACTATCGTCCGACTCTCCGTCGTAC
TTTACACGACACTTCTCGCAAGCGACCGACGTCCATCGCCCGCTCTACATCGACCGCGACCCGGACACGTTCCGT
GACATGGAGCTTCATCTTCAAGGCTACCACGTCAGCGCCAGGGATGGAACGCACCTGGTGCGGCTCTTATCCGAT
GCGCGTTTCTACAGCCTCGCGAAGCTCACGTCGCAGCTCTACGAAGCAGACGTCTTCGTCTCCGTCGGCGGACGC
GAGTTTCGACTATCGCGCCGTCTGCTCACCAGTCCCACCAACTCGCCCAACTTCTTCTCGCTCTTTATCTCCGGC
GTTGACCGAGGCCGTGACAACGATGGCGATGGCGACGGCGGCGACGACGACGACGACGACGACGACGACGACGAC
GGTGGTGGTGGTGGTACAGGTGCCGACATGGTGATGCCCGGACCGTCGCTGCCGAATCGCTCGGCCGAGACGTTT
GCCGAGTTGGTCCGCTTGCTGTGCGGTTATCGTCCTCGTCAGTGGGATGAGACGCTGAGGAGGGATCTGTTGCAG
GACGCGCGGTACTTTGGCTTCAAGGGCGTTGAGCAGATGCTGATTCCGCATGCCTTGAGCTACAATCCCGTTCTC
GTCAGGCACGAGATTTGCATTCTACTTGATAACGTGCAGAAGAGCGGCGTCAGCATCTCTCCTCAAGCACAGCAG
CATCAAGGCGAGACGATAGCCTGGGTGCAATACGCGCGTCCGCTCATCGACGACGCACCTGCAGACCTCATCGTC
GAGATGGGCTCCGACTCGACGCGCCTCCTCTGGGGCTCCGACGGTCCCCGCGCGGATTTCTCGGGCGAAACACGC
GCCCGCGTCGCCAAACTCCTCTCCGTACTGGCCGGGAAGATGAGCCTCCCTCCCACAACGCAACCCCTAGGCCTC
CTGATGGCCTCGGGCGGCGCATCCTCGCAGCCCCCTACGCCGGGCAACACGCCCCTGAGCGCAGACCTAGTCCGC
GTCTCCATGACGCGCGACACGGCCGTCGTCCTGGACGGGACATGTCTGGTCGTCGGGGGGGAGACGGGCGGTGAT
GACGAGGGGGGTTCGCGGAAGAGGAGGCGGGTCACGCGCGGGGGGAGGTTTGGTTCGTGA
Gene >Ophcf2|05746
ATGGCTTCGACGAGCCCAAGTGATGCTCACGACTTGACGCCTGCCGGGCCTCATCAGACGCTGCCTCCCAATCAC
CTGTTCGCCATCCAGGTCGGGCACCAGATGTTCAAGTTATCAGGCGCCTCACTATCGTCCGACTGTCAGTGCTGA
GCTCTCTCTCACTCTCCCTCTCTCCATACCAATCCTCTCATTCTTACGGCGAGTCCAGCTCCGTCGTACTTTACA
CGACACTTCTCGCAAGCGACCGACGTCCATCGCCCGCTCTACATCGACCGCGACCCGGACACGTTCCGTGACATG
GAGCTTCATCTTCAAGGCTACCACGTCAGCGCCAGGGATGGAACGCACCTGGTGCGGCTCTTATCCGATGCGCGT
TTCTACAGCCGTGCGTGCCTTGTGAGATGTAGATGTAGAGGAGAAGAAGATGGGAGAAGAATGTTGGGAGGATGA
AGATGGGAAAGAAAAGCTGATTTGATGCGGCCCGTGCCTCTCGCAGCCACCATTTCTTCCCTATAGTCGCGAAGC
TCACGTCGCAGCTCTACGAAGCAGACGTCTTCGTCTCCGTCGGCGGACGCGAGTTTCGACTATCGCGCCGTCTGC
TCACCAGTCCCACCAACTCGCCCAACTTCTTCTCGCTCTTTATCTCCGGCGTTGACCGAGGCCGTGACAACGATG
GCGATGGCGACGGCGGCGACGACGACGACGACGACGACGACGACGACGACGGTGGTGGTGGTGGTACAGGTGCCG
ACATGGTGATGCCCGGACCGTCGCTGCCGAATCGCTCGGCCGAGACGTTTGCCGAGTTGGTCCGCTTGCTGTGCG
GTTATCGTCCTCGTCAGTGGGATGAGACGCTGAGGAGGGATCTGTTGCAGGACGCGCGGTACTTTGGCTTCAAGG
GCGTTGAGCAGATGCTGATTCCGCATGCCTTGAGCTACAATCCCGTTCTCGTCAGGCACGAGATTTGCATTCTAC
TTGATAACGTGCAGAAGAGCGGCGTCAGCATCTCTCCTCAAGCACAGCAGCATCAAGGCGAGACGATAGCCTGGG
TGCAATACGCGCGTCCGCTCATCGACGACGCACCTGCAGACCTCATCGTCGAGATGGGCTCCGACTCGACGCGCC
TCCTCTGGGGCTCCGACGGTCCCCGCGCGGATTTCTCGGGCGAAACACGCGCCCGCGTCGCCAAACTCCTCTCCG
TACTGGCCGGGAAGATGAGCCTCCCTCCCACAACGCAACCCCTAGGCCTCCTGATGGCCTCGGGCGGCGCATCCT
CGCAGCCCCCTACGCCGGGCAACACGCCCCTGAGCGCAGACCTAGTCCGCGTCTCCATGACGCGCGACACGGCCG
TCGTCCTGGACGGGACATGTCTGGTCGTCGGGGGGGAGACGGGCGGTGATGACGAGGGGGGTTCGCGGAAGAGGA
GGCGGGTCACGCGCGGGGGGAGGTTTGGTTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail