Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05736
Gene name
Locationscaffold_06:2141757..2147953
Strand-
Gene length (bp)6196
Transcript length (bp)6117
Coding sequence length (bp)6117
Protein length (aa) 2039

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16172 DOCK_N DOCK N-terminus 2.0E-117 177 612
PF14429 DOCK-C2 C2 domain in Dock180 and Zizimin proteins 5.2E-34 615 809
PF06920 DHR-2_Lobe_A DHR-2, Lobe A 3.6E-06 1448 1572

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6915 0.2361 0.1215 0.4952 0.1658 0.0299 0.2348 0.2317 0.2701 0.0588

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3011
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2218
Ophiocordyceps australis map64 (Brazil) OphauB2|1144
Ophiocordyceps camponoti-floridani Ophcf2|05736 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1633
Ophiocordyceps kimflemingae Ophio5|2093
Ophiocordyceps subramaniannii Hirsu2|5201

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05736
MPWQPLPRIAFAVATFPFTAENPADLPLEIGDELYIIEETPDGNWLRGYLVAPPSILAGLTSVKGQTLEARVFSG
IFPRSCVEVRELLGESDHGRDSDGGCRTHSTADVDVMVDPRPASDSAKSGFTSGNSPTKDATYSGSTRERNPLSE
LPNGILGKLSVPLKRDVHAPRPAAPVPMLKIGDETPTSTSEPLIDEISSCLREWHSKHLHELLLSRKYAELDELS
GLVARLNLHRQQFLYNVLTAHESERLRERTVWDLVRVSKISGGQVIVRDPAARGRVMTGDDSAVGITMLQSQMSL
LDEPPQPTAELSSLHHLLLEVKGFAGSSAEETSLMIYLVSKTQHGTVSNLSECFHVEIPPGGTIGSLAPNSSTRT
LFTDLSPQDVGDAPPADSELYLVVKALAPQQIAFASPLSRSGTVTDYSGHSRDQSKSPSVGAANRYSRRSLMWGG
KGSRHTLSRGYGLPKMDPLSEQQEDTARNSEMESREGHYPPGSACSTSASGGATSQTVQRTVGVGVLKLNPFMKQ
FNEVEQVVNIWSPAVTRSSLEKDNKAPWDSLIREVLEKPNGQFEKSRRGERLQIGLQTFTDLDADALIKTTPTLL
SGVSKTSRIGFSGAPSKPRSDIYLTINSATLARHHLLSRYGASATALPSGFLGGNLQFALEIRGPSGQRFENCIF
ASSNDEALTTFRSVAADRGEPWNHTLRLHLSPDDVPNAHVVIFLSDLPNHPFAVAHMPLWDREAFQRDGRHGLLL
YKLDENTATAQAGPTGKGGYLSLPWAVRGKDAHSPDVTGPLAALLVDTFLCSTKFSQDRVILGLLKWKDLSSVED
MASVLRQLVFVPEIEVVKLLSDVFDGLFGILVEHSGNDELEDLIFTALVRVLGIVHDRRFNLGPLVEQYAENQFK
YPFATTSLVRSFTRLLEHPTEPETARTLRATFKVVKHILKFISHARGQMRAKEAVIGITSSPHGFTRQLRSIFKE
LDAMMRNPSPVLVGSQTLAVQHFHTWLPELSGLMTAEEILHVAIDFMDSCTDVRGKLILYKLVLIVNYSKLDVFA
HADQKAALCANTVRWIAPHWGHSDDVDGQWRDQVRLCCSVIASQVDQLGPEIPDHLPRIMDSYLAMQSSPPKPRH
RLSLLFPTSYPFPSRAVAEEVTFDEALAELSAILSAVSASSVGMQLEVAEGDVTVMLENLLQVHMSILSGDAFPL
SWLSVHIHHHKSTMRTLTYLAGILLESYLPDADEAETFNTQLWKLFFQTLLKLVGSTSLALETFPEQRRRAVWKI
AGDVREHGAELLRDTWEAVGWDTSPDELSRYGLPRVGGYQVQYVPSLVGPIVELCLSVHEGLRRMAVEVLQTMIV
SEWSLSEDLTAVQTEAVDCLDRFFKSTPVTESMLQKLFVGELLERFERMADTVDDGLYRAVKDLTSTLDEFLDLL
VAVHSSQEGNEASSIINQLRLMEFLRDMQKEEIFIRYVHQLASFQASTGNSGEAGLALRLHADLYAWDPTRQAPA
LTEPEFPAQTQFERKERIYFDMIKHFEEGESWSNALAAYKELQTQYESNVFDFAKLARTDRAMATIYDKISKCDK
MTPRYFKVVYKGLGFPSSLRDKEFVFEGSLAERVSAFSDRLQEQFPSAKMVTTGDVDEVEGQFLVVSTISPHRDL
AHPVYQRARVPQVVRDYMLCAHPQTFSVTKRRHTSGPVEGHYAEKTMMTTSEPFPTLLRRSEIVETQELRLNAHE
TGLERIVRKTQEMAALERRLADGDGDGAQQLLDAVTIAVNPSSEHSVVCYRALIAEPGRDEDEEAVEEAELEPQE
TALRMALMDHALVIKKCLATFARSANEVLLRKQEELSLRFEDTFEQEIATFTPPPPPVPREATPTPSTAFRGSLP
PDKRSQWPKTASPLNGGAKAEETAVVQRVSTRHRGARLSFLSGRKPEAEQAAEADRPNGGTDATSSPRVSVSKAS
GLRHSIFRSQSMNEGGDDQGVGLRQRSGSAGKESLDGGLAADGGQTVDKEEPTLTKRGSMRKRLSKLNVKLGKKG
AKGGWAMGSLNEE*
Coding >Ophcf2|05736
ATGCCCTGGCAGCCTCTCCCCCGCATAGCCTTCGCCGTCGCGACTTTCCCCTTCACCGCCGAGAACCCTGCCGAC
CTGCCGCTCGAGATTGGCGATGAGCTGTACATTATCGAGGAGACGCCCGACGGGAACTGGCTACGGGGCTATCTC
GTTGCGCCTCCCAGCATCTTGGCCGGTCTGACTTCCGTCAAGGGCCAGACTCTCGAGGCTCGCGTCTTCAGCGGC
ATCTTCCCGCGCAGCTGTGTCGAGGTTCGCGAGCTGCTCGGTGAGTCTGATCATGGACGGGATAGTGACGGCGGC
TGCCGCACCCATTCGACAGCCGACGTCGATGTCATGGTCGATCCCCGGCCTGCTAGCGACTCTGCCAAGAGCGGC
TTCACGAGCGGCAACTCGCCGACCAAAGACGCTACCTACTCTGGGTCGACCCGTGAGAGGAACCCCCTGAGCGAG
CTCCCCAATGGAATCCTCGGCAAGCTCTCCGTTCCCTTGAAGAGGGATGTCCACGCGCCGCGACCCGCAGCGCCT
GTGCCAATGCTCAAGATTGGCGACGAGACGCCCACGTCCACCTCGGAACCTTTGATAGACGAAATCTCATCCTGT
CTACGGGAATGGCACTCCAAGCACCTCCACGAGCTGCTTCTTTCGCGGAAATACGCTGAGCTGGACGAGCTGTCG
GGGCTCGTTGCCCGTCTCAACCTCCATCGTCAGCAGTTTCTCTACAATGTCTTGACGGCCCACGAATCCGAGCGG
CTGCGCGAAAGGACCGTCTGGGATCTTGTCAGGGTCAGCAAGATCAGCGGCGGCCAAGTAATAGTGCGCGATCCA
GCGGCCCGCGGCCGAGTAATGACGGGCGACGACTCTGCCGTGGGCATCACCATGCTCCAGTCTCAGATGAGTCTG
CTGGACGAGCCTCCTCAGCCTACGGCCGAGTTGTCCAGCTTGCATCATCTCCTGCTGGAAGTCAAGGGATTCGCG
GGCTCGTCTGCGGAGGAGACGTCGCTGATGATCTATCTCGTCAGCAAGACGCAACATGGTACCGTCTCCAACCTT
TCCGAGTGTTTCCACGTCGAGATACCGCCCGGCGGAACTATAGGGAGCCTTGCCCCAAACTCGTCGACTAGAACT
CTCTTCACCGACCTGTCGCCTCAGGATGTCGGCGACGCTCCGCCTGCAGACTCGGAGCTGTACCTCGTCGTCAAG
GCCCTGGCGCCTCAGCAAATCGCCTTTGCGTCTCCTCTTTCGCGCTCGGGTACCGTCACAGACTACAGTGGGCAT
TCAAGGGATCAGTCAAAGTCGCCGTCTGTAGGGGCTGCAAACAGATACTCGAGGAGGAGTCTGATGTGGGGTGGC
AAGGGTAGCCGTCATACGCTCTCGAGAGGATACGGCTTGCCCAAGATGGATCCGCTCTCGGAGCAGCAGGAAGAC
ACGGCAAGGAACTCTGAGATGGAGAGTCGAGAGGGTCATTACCCGCCCGGCAGCGCGTGCTCGACGAGTGCCTCT
GGCGGGGCGACTTCTCAAACGGTGCAAAGAACGGTGGGCGTCGGGGTTCTGAAGCTCAACCCGTTCATGAAGCAG
TTCAACGAGGTCGAACAGGTCGTCAACATCTGGTCTCCGGCAGTTACACGATCCAGTTTGGAAAAGGATAACAAG
GCGCCTTGGGATTCTCTGATCCGCGAAGTGCTGGAGAAGCCAAACGGGCAGTTTGAAAAGTCACGACGCGGCGAG
CGCCTCCAAATCGGCCTTCAGACCTTCACCGACCTCGATGCCGATGCTCTCATCAAGACGACGCCGACTCTTCTC
TCAGGTGTCTCGAAAACGAGCAGAATCGGCTTCTCCGGAGCACCCTCTAAGCCGAGATCTGACATCTACCTGACC
ATCAACTCGGCCACACTGGCTCGGCACCATCTCCTGTCACGGTACGGAGCCAGCGCGACGGCTCTGCCATCCGGC
TTCCTGGGAGGCAACCTGCAATTTGCCCTGGAGATCCGCGGGCCTTCGGGTCAGCGATTTGAGAATTGCATCTTC
GCCTCATCCAACGACGAGGCCCTGACCACGTTCCGATCAGTGGCCGCAGACAGGGGAGAGCCGTGGAATCACACG
CTCCGGCTTCATCTGTCCCCCGACGATGTCCCTAACGCGCACGTCGTCATCTTCCTCTCCGACTTGCCCAACCAC
CCCTTTGCCGTCGCACACATGCCGCTCTGGGATCGGGAAGCCTTCCAGCGCGACGGTCGACACGGCCTGTTGCTT
TACAAGTTGGACGAGAACACGGCGACCGCGCAGGCCGGTCCGACCGGCAAAGGCGGCTATCTGTCGCTCCCCTGG
GCTGTTCGAGGCAAAGATGCGCACTCACCCGACGTCACCGGACCCTTGGCCGCCCTGCTTGTCGATACCTTTCTC
TGTAGCACCAAGTTTTCTCAAGACAGGGTGATACTGGGTCTTCTCAAATGGAAGGACTTGTCGTCAGTGGAAGAC
ATGGCCTCGGTCTTGAGGCAGCTGGTCTTCGTGCCCGAAATCGAAGTCGTCAAGCTCTTGAGCGATGTCTTTGAC
GGGCTTTTCGGCATCCTCGTCGAGCATTCGGGCAACGACGAGCTGGAAGACTTGATATTCACAGCCCTAGTCCGC
GTGCTCGGCATCGTGCATGACCGGAGGTTCAACCTCGGCCCATTGGTTGAGCAGTACGCCGAGAATCAGTTCAAG
TACCCGTTCGCCACGACGAGCCTGGTCAGGTCTTTTACGCGGCTCCTGGAGCATCCCACGGAGCCTGAGACGGCA
CGTACGCTGAGGGCTACCTTTAAAGTGGTCAAACATATCCTCAAGTTCATCTCACACGCGAGGGGCCAGATGAGG
GCGAAGGAGGCCGTGATAGGCATCACATCCTCTCCGCACGGTTTCACGCGACAGCTGCGGTCGATCTTCAAGGAA
CTCGACGCAATGATGCGCAACCCCAGCCCCGTCTTGGTAGGCAGCCAGACGCTGGCTGTCCAACACTTCCACACA
TGGCTGCCCGAACTCAGCGGTCTCATGACGGCCGAGGAGATCTTGCACGTGGCCATAGACTTTATGGACTCGTGT
ACCGACGTCAGGGGCAAGTTAATCCTTTACAAGCTGGTCCTCATCGTCAACTATTCCAAGCTGGACGTCTTCGCG
CACGCAGATCAAAAGGCTGCTCTGTGTGCCAACACGGTTCGCTGGATCGCGCCCCATTGGGGCCACAGCGACGAC
GTCGACGGCCAGTGGCGAGACCAGGTTCGTCTGTGCTGCTCCGTCATCGCCAGCCAAGTCGATCAGCTCGGTCCG
GAAATACCGGATCACTTGCCGAGGATCATGGACTCTTACCTGGCCATGCAGTCGTCTCCGCCGAAGCCGCGCCAT
CGCCTGTCTCTGTTGTTTCCCACCTCTTATCCGTTCCCGTCCAGGGCCGTCGCCGAGGAGGTCACCTTTGACGAA
GCATTGGCCGAGCTGTCGGCCATTCTGTCCGCCGTATCGGCCTCTTCCGTGGGCATGCAGTTGGAGGTGGCCGAG
GGAGACGTCACCGTCATGCTTGAAAACCTGCTGCAGGTTCACATGAGCATCCTCTCGGGCGATGCCTTTCCGCTG
AGCTGGTTGAGCGTGCACATCCATCACCACAAATCGACGATGCGGACCTTGACGTACCTGGCCGGCATCCTGCTG
GAATCCTACCTGCCAGACGCAGACGAAGCCGAGACTTTCAACACCCAGCTGTGGAAACTCTTCTTCCAGACGCTG
CTCAAGCTAGTCGGCAGCACGTCTCTGGCCCTGGAGACGTTCCCGGAGCAGAGGAGACGCGCGGTGTGGAAGATT
GCGGGAGACGTGAGGGAGCACGGGGCCGAGCTCCTCCGCGACACCTGGGAAGCCGTCGGATGGGACACTTCGCCG
GACGAGCTCAGCCGCTACGGACTGCCGAGGGTCGGGGGCTACCAAGTGCAGTACGTGCCGTCGCTGGTGGGACCC
ATCGTTGAGCTGTGCTTGAGCGTCCACGAGGGACTTCGGCGGATGGCGGTCGAGGTGTTGCAGACGATGATTGTC
AGCGAATGGTCGCTGAGCGAGGACCTGACGGCGGTGCAGACGGAGGCGGTCGACTGTCTGGACCGTTTCTTCAAG
TCGACGCCCGTGACGGAGAGTATGCTGCAGAAGCTCTTCGTCGGGGAACTCTTGGAAAGGTTCGAGCGGATGGCA
GACACGGTGGACGATGGGCTCTACAGGGCCGTCAAAGACCTGACCTCGACGCTGGACGAGTTCCTCGATCTGCTG
GTGGCCGTGCACAGCAGCCAAGAGGGCAACGAGGCGTCATCCATCATCAATCAGCTGCGGTTGATGGAGTTCTTG
CGAGACATGCAGAAGGAGGAAATCTTCATCCGCTACGTTCACCAGCTGGCTTCCTTCCAGGCCTCGACGGGGAAC
AGTGGCGAGGCCGGTCTGGCTCTGCGGCTACACGCCGATCTCTACGCCTGGGATCCGACGCGGCAGGCTCCGGCC
CTGACGGAGCCCGAGTTCCCGGCGCAGACGCAGTTTGAGCGCAAGGAACGCATCTACTTTGACATGATCAAGCAC
TTTGAGGAAGGCGAGTCGTGGAGCAACGCGCTGGCAGCGTACAAGGAGCTGCAGACGCAGTACGAGAGCAACGTC
TTCGACTTTGCCAAGCTGGCGAGGACGGATCGAGCCATGGCGACGATATACGATAAGATTTCCAAGTGCGACAAG
ATGACGCCGCGATACTTCAAGGTCGTCTACAAGGGCCTGGGCTTCCCGTCGAGTCTCCGGGACAAGGAGTTCGTC
TTTGAGGGATCGCTGGCCGAGCGCGTCTCCGCCTTCAGCGATCGCCTGCAGGAGCAGTTCCCGTCGGCCAAGATG
GTGACGACGGGCGACGTCGATGAGGTCGAGGGGCAGTTCCTCGTTGTCTCGACCATCAGTCCTCACCGCGACTTG
GCTCACCCGGTGTATCAGAGGGCCCGTGTGCCTCAAGTCGTGCGCGACTACATGCTGTGCGCGCATCCTCAGACC
TTCTCCGTCACCAAGAGAAGGCACACGTCAGGACCGGTAGAGGGTCATTACGCGGAGAAGACGATGATGACGACG
TCGGAGCCGTTTCCGACTCTGCTGCGACGGAGCGAGATTGTGGAAACGCAAGAGCTTCGGCTCAACGCTCACGAG
ACTGGGCTGGAGCGCATCGTGCGAAAGACGCAGGAGATGGCAGCCCTGGAGCGTCGCCTGGCAGACGGAGACGGA
GACGGCGCCCAACAGCTACTAGATGCCGTCACCATCGCCGTCAACCCTTCCTCGGAGCACAGCGTCGTCTGCTAC
CGAGCCCTGATAGCGGAACCGGGCCGAGACGAGGATGAGGAGGCGGTCGAGGAGGCGGAGCTCGAGCCTCAGGAG
ACGGCCCTGCGGATGGCGCTGATGGACCATGCCCTGGTCATCAAGAAGTGCTTGGCCACGTTTGCCCGAAGCGCC
AACGAGGTGCTTCTTCGGAAGCAAGAGGAACTCAGTCTCCGCTTCGAGGACACGTTCGAGCAAGAGATTGCCACA
TTCACCCCGCCGCCGCCTCCCGTGCCGCGCGAGGCGACGCCGACGCCGTCCACGGCCTTTAGGGGCTCTCTCCCT
CCGGACAAGCGGTCTCAGTGGCCAAAGACGGCGAGCCCGCTGAACGGAGGCGCCAAAGCGGAAGAGACGGCCGTC
GTGCAGCGGGTGTCGACGCGGCATCGCGGTGCGAGACTGAGCTTCCTCAGCGGACGGAAGCCCGAAGCCGAGCAG
GCTGCCGAGGCGGACAGGCCCAACGGCGGCACCGACGCGACGAGCTCTCCCAGAGTCAGCGTCAGCAAGGCGTCG
GGCCTGCGGCACAGCATCTTCCGGTCACAGTCGATGAACGAGGGCGGCGATGACCAGGGCGTCGGGCTGAGGCAG
CGGAGCGGCTCGGCAGGCAAGGAGAGTCTCGATGGCGGGTTGGCGGCGGACGGGGGACAGACGGTTGATAAGGAG
GAGCCTACGCTCACGAAGCGGGGGAGTATGAGGAAGAGGCTCAGCAAGTTGAATGTGAAGCTGGGGAAGAAGGGG
GCCAAGGGGGGTTGGGCTATGGGGAGTCTGAATGAGGAGTAG
Transcript >Ophcf2|05736
ATGCCCTGGCAGCCTCTCCCCCGCATAGCCTTCGCCGTCGCGACTTTCCCCTTCACCGCCGAGAACCCTGCCGAC
CTGCCGCTCGAGATTGGCGATGAGCTGTACATTATCGAGGAGACGCCCGACGGGAACTGGCTACGGGGCTATCTC
GTTGCGCCTCCCAGCATCTTGGCCGGTCTGACTTCCGTCAAGGGCCAGACTCTCGAGGCTCGCGTCTTCAGCGGC
ATCTTCCCGCGCAGCTGTGTCGAGGTTCGCGAGCTGCTCGGTGAGTCTGATCATGGACGGGATAGTGACGGCGGC
TGCCGCACCCATTCGACAGCCGACGTCGATGTCATGGTCGATCCCCGGCCTGCTAGCGACTCTGCCAAGAGCGGC
TTCACGAGCGGCAACTCGCCGACCAAAGACGCTACCTACTCTGGGTCGACCCGTGAGAGGAACCCCCTGAGCGAG
CTCCCCAATGGAATCCTCGGCAAGCTCTCCGTTCCCTTGAAGAGGGATGTCCACGCGCCGCGACCCGCAGCGCCT
GTGCCAATGCTCAAGATTGGCGACGAGACGCCCACGTCCACCTCGGAACCTTTGATAGACGAAATCTCATCCTGT
CTACGGGAATGGCACTCCAAGCACCTCCACGAGCTGCTTCTTTCGCGGAAATACGCTGAGCTGGACGAGCTGTCG
GGGCTCGTTGCCCGTCTCAACCTCCATCGTCAGCAGTTTCTCTACAATGTCTTGACGGCCCACGAATCCGAGCGG
CTGCGCGAAAGGACCGTCTGGGATCTTGTCAGGGTCAGCAAGATCAGCGGCGGCCAAGTAATAGTGCGCGATCCA
GCGGCCCGCGGCCGAGTAATGACGGGCGACGACTCTGCCGTGGGCATCACCATGCTCCAGTCTCAGATGAGTCTG
CTGGACGAGCCTCCTCAGCCTACGGCCGAGTTGTCCAGCTTGCATCATCTCCTGCTGGAAGTCAAGGGATTCGCG
GGCTCGTCTGCGGAGGAGACGTCGCTGATGATCTATCTCGTCAGCAAGACGCAACATGGTACCGTCTCCAACCTT
TCCGAGTGTTTCCACGTCGAGATACCGCCCGGCGGAACTATAGGGAGCCTTGCCCCAAACTCGTCGACTAGAACT
CTCTTCACCGACCTGTCGCCTCAGGATGTCGGCGACGCTCCGCCTGCAGACTCGGAGCTGTACCTCGTCGTCAAG
GCCCTGGCGCCTCAGCAAATCGCCTTTGCGTCTCCTCTTTCGCGCTCGGGTACCGTCACAGACTACAGTGGGCAT
TCAAGGGATCAGTCAAAGTCGCCGTCTGTAGGGGCTGCAAACAGATACTCGAGGAGGAGTCTGATGTGGGGTGGC
AAGGGTAGCCGTCATACGCTCTCGAGAGGATACGGCTTGCCCAAGATGGATCCGCTCTCGGAGCAGCAGGAAGAC
ACGGCAAGGAACTCTGAGATGGAGAGTCGAGAGGGTCATTACCCGCCCGGCAGCGCGTGCTCGACGAGTGCCTCT
GGCGGGGCGACTTCTCAAACGGTGCAAAGAACGGTGGGCGTCGGGGTTCTGAAGCTCAACCCGTTCATGAAGCAG
TTCAACGAGGTCGAACAGGTCGTCAACATCTGGTCTCCGGCAGTTACACGATCCAGTTTGGAAAAGGATAACAAG
GCGCCTTGGGATTCTCTGATCCGCGAAGTGCTGGAGAAGCCAAACGGGCAGTTTGAAAAGTCACGACGCGGCGAG
CGCCTCCAAATCGGCCTTCAGACCTTCACCGACCTCGATGCCGATGCTCTCATCAAGACGACGCCGACTCTTCTC
TCAGGTGTCTCGAAAACGAGCAGAATCGGCTTCTCCGGAGCACCCTCTAAGCCGAGATCTGACATCTACCTGACC
ATCAACTCGGCCACACTGGCTCGGCACCATCTCCTGTCACGGTACGGAGCCAGCGCGACGGCTCTGCCATCCGGC
TTCCTGGGAGGCAACCTGCAATTTGCCCTGGAGATCCGCGGGCCTTCGGGTCAGCGATTTGAGAATTGCATCTTC
GCCTCATCCAACGACGAGGCCCTGACCACGTTCCGATCAGTGGCCGCAGACAGGGGAGAGCCGTGGAATCACACG
CTCCGGCTTCATCTGTCCCCCGACGATGTCCCTAACGCGCACGTCGTCATCTTCCTCTCCGACTTGCCCAACCAC
CCCTTTGCCGTCGCACACATGCCGCTCTGGGATCGGGAAGCCTTCCAGCGCGACGGTCGACACGGCCTGTTGCTT
TACAAGTTGGACGAGAACACGGCGACCGCGCAGGCCGGTCCGACCGGCAAAGGCGGCTATCTGTCGCTCCCCTGG
GCTGTTCGAGGCAAAGATGCGCACTCACCCGACGTCACCGGACCCTTGGCCGCCCTGCTTGTCGATACCTTTCTC
TGTAGCACCAAGTTTTCTCAAGACAGGGTGATACTGGGTCTTCTCAAATGGAAGGACTTGTCGTCAGTGGAAGAC
ATGGCCTCGGTCTTGAGGCAGCTGGTCTTCGTGCCCGAAATCGAAGTCGTCAAGCTCTTGAGCGATGTCTTTGAC
GGGCTTTTCGGCATCCTCGTCGAGCATTCGGGCAACGACGAGCTGGAAGACTTGATATTCACAGCCCTAGTCCGC
GTGCTCGGCATCGTGCATGACCGGAGGTTCAACCTCGGCCCATTGGTTGAGCAGTACGCCGAGAATCAGTTCAAG
TACCCGTTCGCCACGACGAGCCTGGTCAGGTCTTTTACGCGGCTCCTGGAGCATCCCACGGAGCCTGAGACGGCA
CGTACGCTGAGGGCTACCTTTAAAGTGGTCAAACATATCCTCAAGTTCATCTCACACGCGAGGGGCCAGATGAGG
GCGAAGGAGGCCGTGATAGGCATCACATCCTCTCCGCACGGTTTCACGCGACAGCTGCGGTCGATCTTCAAGGAA
CTCGACGCAATGATGCGCAACCCCAGCCCCGTCTTGGTAGGCAGCCAGACGCTGGCTGTCCAACACTTCCACACA
TGGCTGCCCGAACTCAGCGGTCTCATGACGGCCGAGGAGATCTTGCACGTGGCCATAGACTTTATGGACTCGTGT
ACCGACGTCAGGGGCAAGTTAATCCTTTACAAGCTGGTCCTCATCGTCAACTATTCCAAGCTGGACGTCTTCGCG
CACGCAGATCAAAAGGCTGCTCTGTGTGCCAACACGGTTCGCTGGATCGCGCCCCATTGGGGCCACAGCGACGAC
GTCGACGGCCAGTGGCGAGACCAGGTTCGTCTGTGCTGCTCCGTCATCGCCAGCCAAGTCGATCAGCTCGGTCCG
GAAATACCGGATCACTTGCCGAGGATCATGGACTCTTACCTGGCCATGCAGTCGTCTCCGCCGAAGCCGCGCCAT
CGCCTGTCTCTGTTGTTTCCCACCTCTTATCCGTTCCCGTCCAGGGCCGTCGCCGAGGAGGTCACCTTTGACGAA
GCATTGGCCGAGCTGTCGGCCATTCTGTCCGCCGTATCGGCCTCTTCCGTGGGCATGCAGTTGGAGGTGGCCGAG
GGAGACGTCACCGTCATGCTTGAAAACCTGCTGCAGGTTCACATGAGCATCCTCTCGGGCGATGCCTTTCCGCTG
AGCTGGTTGAGCGTGCACATCCATCACCACAAATCGACGATGCGGACCTTGACGTACCTGGCCGGCATCCTGCTG
GAATCCTACCTGCCAGACGCAGACGAAGCCGAGACTTTCAACACCCAGCTGTGGAAACTCTTCTTCCAGACGCTG
CTCAAGCTAGTCGGCAGCACGTCTCTGGCCCTGGAGACGTTCCCGGAGCAGAGGAGACGCGCGGTGTGGAAGATT
GCGGGAGACGTGAGGGAGCACGGGGCCGAGCTCCTCCGCGACACCTGGGAAGCCGTCGGATGGGACACTTCGCCG
GACGAGCTCAGCCGCTACGGACTGCCGAGGGTCGGGGGCTACCAAGTGCAGTACGTGCCGTCGCTGGTGGGACCC
ATCGTTGAGCTGTGCTTGAGCGTCCACGAGGGACTTCGGCGGATGGCGGTCGAGGTGTTGCAGACGATGATTGTC
AGCGAATGGTCGCTGAGCGAGGACCTGACGGCGGTGCAGACGGAGGCGGTCGACTGTCTGGACCGTTTCTTCAAG
TCGACGCCCGTGACGGAGAGTATGCTGCAGAAGCTCTTCGTCGGGGAACTCTTGGAAAGGTTCGAGCGGATGGCA
GACACGGTGGACGATGGGCTCTACAGGGCCGTCAAAGACCTGACCTCGACGCTGGACGAGTTCCTCGATCTGCTG
GTGGCCGTGCACAGCAGCCAAGAGGGCAACGAGGCGTCATCCATCATCAATCAGCTGCGGTTGATGGAGTTCTTG
CGAGACATGCAGAAGGAGGAAATCTTCATCCGCTACGTTCACCAGCTGGCTTCCTTCCAGGCCTCGACGGGGAAC
AGTGGCGAGGCCGGTCTGGCTCTGCGGCTACACGCCGATCTCTACGCCTGGGATCCGACGCGGCAGGCTCCGGCC
CTGACGGAGCCCGAGTTCCCGGCGCAGACGCAGTTTGAGCGCAAGGAACGCATCTACTTTGACATGATCAAGCAC
TTTGAGGAAGGCGAGTCGTGGAGCAACGCGCTGGCAGCGTACAAGGAGCTGCAGACGCAGTACGAGAGCAACGTC
TTCGACTTTGCCAAGCTGGCGAGGACGGATCGAGCCATGGCGACGATATACGATAAGATTTCCAAGTGCGACAAG
ATGACGCCGCGATACTTCAAGGTCGTCTACAAGGGCCTGGGCTTCCCGTCGAGTCTCCGGGACAAGGAGTTCGTC
TTTGAGGGATCGCTGGCCGAGCGCGTCTCCGCCTTCAGCGATCGCCTGCAGGAGCAGTTCCCGTCGGCCAAGATG
GTGACGACGGGCGACGTCGATGAGGTCGAGGGGCAGTTCCTCGTTGTCTCGACCATCAGTCCTCACCGCGACTTG
GCTCACCCGGTGTATCAGAGGGCCCGTGTGCCTCAAGTCGTGCGCGACTACATGCTGTGCGCGCATCCTCAGACC
TTCTCCGTCACCAAGAGAAGGCACACGTCAGGACCGGTAGAGGGTCATTACGCGGAGAAGACGATGATGACGACG
TCGGAGCCGTTTCCGACTCTGCTGCGACGGAGCGAGATTGTGGAAACGCAAGAGCTTCGGCTCAACGCTCACGAG
ACTGGGCTGGAGCGCATCGTGCGAAAGACGCAGGAGATGGCAGCCCTGGAGCGTCGCCTGGCAGACGGAGACGGA
GACGGCGCCCAACAGCTACTAGATGCCGTCACCATCGCCGTCAACCCTTCCTCGGAGCACAGCGTCGTCTGCTAC
CGAGCCCTGATAGCGGAACCGGGCCGAGACGAGGATGAGGAGGCGGTCGAGGAGGCGGAGCTCGAGCCTCAGGAG
ACGGCCCTGCGGATGGCGCTGATGGACCATGCCCTGGTCATCAAGAAGTGCTTGGCCACGTTTGCCCGAAGCGCC
AACGAGGTGCTTCTTCGGAAGCAAGAGGAACTCAGTCTCCGCTTCGAGGACACGTTCGAGCAAGAGATTGCCACA
TTCACCCCGCCGCCGCCTCCCGTGCCGCGCGAGGCGACGCCGACGCCGTCCACGGCCTTTAGGGGCTCTCTCCCT
CCGGACAAGCGGTCTCAGTGGCCAAAGACGGCGAGCCCGCTGAACGGAGGCGCCAAAGCGGAAGAGACGGCCGTC
GTGCAGCGGGTGTCGACGCGGCATCGCGGTGCGAGACTGAGCTTCCTCAGCGGACGGAAGCCCGAAGCCGAGCAG
GCTGCCGAGGCGGACAGGCCCAACGGCGGCACCGACGCGACGAGCTCTCCCAGAGTCAGCGTCAGCAAGGCGTCG
GGCCTGCGGCACAGCATCTTCCGGTCACAGTCGATGAACGAGGGCGGCGATGACCAGGGCGTCGGGCTGAGGCAG
CGGAGCGGCTCGGCAGGCAAGGAGAGTCTCGATGGCGGGTTGGCGGCGGACGGGGGACAGACGGTTGATAAGGAG
GAGCCTACGCTCACGAAGCGGGGGAGTATGAGGAAGAGGCTCAGCAAGTTGAATGTGAAGCTGGGGAAGAAGGGG
GCCAAGGGGGGTTGGGCTATGGGGAGTCTGAATGAGGAGTAG
Gene >Ophcf2|05736
ATGCCCTGGCAGCCTCTCCCCCGCATAGCCTTCGCCGTCGCGACTTTCCCCTTCACCGCCGAGAACCCTGCCGAC
CTGCCGCTCGAGATTGGCGATGAGCTGTACATTATCGAGGAGACGCCCGACGGGAACTGGCTACGGGGCTATCTC
GTTGCGCCTCCCAGCATCTTGGCCGGTCTGACTTCCGTCAAGGGCCAGACTCTCGAGGCTCGCGTCTTCAGCGGC
ATCTTCCCGCGCAGCTGTGTCGAGGTTCGCGAGCTGCTCGGTGAGTCTGATCATGGACGGGATAGTGACGGCGGC
TGCCGCACCCATTCGACAGCCGACGTCGATGTCATGGTCGATCCCCGGCCTGCTAGCGACTCTGCCAAGAGCGGC
TTCACGAGCGGCAACTCGCCGACCAAAGACGCTACCTACTCTGGGTCGACCCGTGAGAGGAACCCCCTGAGCGAG
CTCCCCAATGGAATCCTCGGCAAGCTCTCCGTTCCCTTGAAGAGGGATGTCCACGCGCCGCGACCCGCAGCGCCT
GTGCCAATGCTCAAGATTGGCGACGAGACGCCCACGTCCACCTCGGAACCTTTGATAGACGAAATCTCATCCTGT
CTACGGGAATGGCACTCCAAGCACCTCCACGAGCTGCTTCTTTCGCGGAAATACGCTGAGCTGGACGAGCTGTCG
GGGCTCGTTGCCCGTCTCAACCTCCATCGTCAGCAGTTTCTCTACAATGTCTTGACGGCCCACGAATCCGAGCGG
CTGCGCGAAAGGACCGTCTGGGATCTTGTCAGGGTCAGCAAGATCAGCGGCGGCCAAGTAATAGTGCGCGATCCA
GCGGCCCGCGGCCGAGTAATGACGGGCGACGACTCTGCCGTGGGCATCACCATGCTCCAGTCTCAGATGAGTCTG
CTGGACGAGCCTCCTCAGCCTACGGCCGAGTTGTCCAGCTTGCATCATCTCCTGCTGGAAGTCAAGGGATTCGCG
GGCTCGTCTGCGGAGGAGACGTCGCTGATGATCTATCTCGTCAGCAAGACGCAACATGGTACCGTCTCCAACCTT
TCCGAGTGTTTCCACGTCGAGATACCGCCCGGCGGAACTATAGGGAGCCTTGCCCCAAACTCGTCGACTAGAACT
CTCTTCACCGACCTGTCGCCTCAGGATGTCGGCGACGCTCCGCCTGCAGACTCGGAGCTGTACCTCGTCGTCAAG
GCCCTGGCGCCTCAGCAAATCGCCTTTGCGTCTCCTCTTTCGCGCTCGGGTACCGTCACAGACTACAGTGGGCAT
TCAAGGGATCAGTCAAAGTCGCCGTCTGTAGGGGCTGCAAACAGATACTCGAGGAGGAGTCTGATGTGGGGTGGC
AAGGGTAGCCGTCATACGCTCTCGAGAGGATACGGCTTGCCCAAGATGGATCCGCTCTCGGAGCAGCAGGAAGAC
ACGGCAAGGAACTCTGAGATGGAGAGTCGAGAGGGTCATTACCCGCCCGGCAGCGCGTGCTCGACGAGTGCCTCT
GGCGGGGCGACTTCTCAAACGGTGCAAAGAACGGTGGGCGTCGGGGTTCTGAAGCTCAACCCGTTCATGAAGCAG
TTCAACGAGGTCGAACAGGTCGTCAACATCTGGTCTCCGGCAGTTACACGATCCAGTTTGGAAAAGGATAACAAG
GCGCCTTGGGATTCTCTGATCCGCGAAGTGCTGGAGAAGCCAAACGGGCAGTTTGAAAAGTCACGACGCGGCGAG
CGCCTCCAAATCGGCCTTCAGACCTTCACCGACCTCGATGCCGATGCTCTCATCAAGACGACGCCGACTCTTCTC
TCAGGTGTCTCGAAAACGAGCAGAATCGGCTTCTCCGGAGCACCCTCTAAGCCGAGATCTGACATCTACCTGACC
ATCAACTCGGCCACACTGGCTCGGCACCATCTCCTGTCACGGTACGGAGCCAGCGCGACGGCTCTGCCATCCGGC
TTCCTGGGAGGCAACCTGCAATTTGCCCTGGAGATCCGCGGGCCTTCGGGTCAGCGATTTGAGAATTGCATCTTC
GCCTCATCCAACGACGAGGCCCTGACCACGTTCCGATCAGTGGCCGCAGACAGGGGAGAGCCGTGGAATCACACG
CTCCGGCTTCATCTGTCCCCCGACGATGTCCCTAACGCGCACGTCGTCATCTTCCTCTCCGACTTGCCCAACCAC
CCCTTTGCCGTCGCACACATGCCGCTCTGGGATCGGGAAGCCTTCCAGCGCGACGGTCGACACGGCCTGTTGCTT
TACAAGTTGGACGAGAACACGGCGACCGCGCAGGCCGGTCCGACCGGCAAAGGCGGCTATCTGTCGCTCCCCTGG
GCTGTTCGAGGCAAAGATGCGCACTCACCCGACGTCACCGGACCCTTGGCCGCCCTGCTTGTCGATACCTTTCTC
TGTAGCACCAAGTTTTCTCAAGACAGGGTGATACTGGGTCTTCTCAAATGGAAGGACTTGTCGTCAGTGGAAGAC
ATGGCCTCGGTCTTGAGGCAGCTGGTCTTCGTGCCCGAAATCGAAGTCGTCAAGCTCTTGAGCGATGTCTTTGAC
GGGCTTTTCGGCATCCTCGTCGAGCATTCGGGCAACGACGAGCTGGAAGACTTGATATTCACAGCCCTAGTCCGC
GTGCTCGGCATCGTGCATGACCGGAGGTTCAACCTCGGCCCATTGGTTGAGCAGTACGCCGAGAATCAGTTCAAG
TACCCGTTCGCCACGACGAGCCTGGTCAGGTCTTTTACGCGGCTCCTGGAGCATCCCACGGAGCCTGAGACGGCA
CGTACGCTGAGGGCTACCTTTAAAGTGGTCAAACATATCCTCAAGTTCATCTCACACGCGAGGGGCCAGATGAGG
GCGAAGGAGGCCGTGATAGGCATCACATCCTCTCCGCACGGTTTCACGCGACAGCTGCGGTCGATCTTCAAGGAA
CTCGACGCAATGATGCGCAACCCCAGCCCCGTCTTGGTAGGCAGCCAGACGCTGGCTGTCCAACACTTCCACACA
TGGCTGCCCGAACTCAGCGGTCTCATGACGGCCGAGGAGATCTTGCACGTGGCCATAGACTTTATGGACTCGTGT
ACCGACGTCAGGGGCAAGTTAATCCTTTACAAGCTGGTCCTCATCGTCAACTATTCCAAGCTGGACGTCTTCGCG
CACGCAGATCAAAAGGCTGCTCTGTGTGCCAACACGGTTCGCTGGATCGCGCCCCATTGGGGCCACAGCGACGAC
GTCGACGGCCAGTGGCGAGACCAGGTTCGTCTGTGCTGCTCCGTCATCGCCAGCCAAGTCGATCAGCTCGGTCCG
GAAATACCGGATCACTTGCCGAGGATCATGGACTCTTACCTGGCCATGCAGTCGTCTCCGCCGAAGCCGCGCCAT
CGCCTGTCTCTGTTGTTTCCCACCTCTTATCCGTTCCCGTCCAGGGCCGTCGCCGAGGAGGTCACCTTTGACGAA
GCATTGGCCGAGCTGTCGGCCATTCTGTCCGCCGTATCGGCCTCTTCCGTGGGCATGCAGTTGGAGGTGGCCGAG
GGAGACGTCACCGTCATGCTTGAAAACCTGCTGCAGGTTCACATGAGCATCCTCTCGGGCGATGCCTTTCCGCTG
AGCTGGTTGAGCGTGCACATCCATCACCACAAATCGACGATGCGGACCTTGACGTACCTGGCCGGCATCCTGCTG
GAATCCTACCTGCCAGACGCAGACGAAGCCGAGACTTTCAACACCCAGCTGTGGAAACTCTTCTTCCAGACGCTG
CTCAAGCTAGTCGGCAGCACGTCTCTGGCCCTGGAGACGTTCCCGGAGCAGAGGAGACGCGCGGTGTGGAAGATT
GCGGGAGACGTGAGGGAGCACGGGGCCGAGCTCCTCCGCGACACCTGGGAAGCCGTCGGATGGGACACTTCGCCG
GACGAGCTCAGCCGCTACGGACTGCCGAGGGTCGGGGGCTACCAAGTGCAGTACGTGCCGTCGCTGGTGGGACCC
ATCGTTGAGCTGTGCTTGAGCGTCCACGAGGGACTTCGGCGGATGGCGGTCGAGGTGTTGCAGACGATGATTGTC
AGCGAATGGTCGCTGAGCGAGGACCTGACGGCGGTGCAGACGGAGGCGGTCGACTGTCTGGACCGTTTCTTCAAG
TCGACGCCCGTGACGGAGAGTATGCTGCAGAAGCTCTTCGTCGGGGAACTCTTGGAAAGGTTCGAGCGGATGGCA
GACACGGTGGACGATGGGCTCTACAGGGCCGTCAAAGACCTGACCTCGACGCTGGACGAGTTCCTCGATCTGCTG
GTGGCCGTGCACAGCAGCCAAGAGGGCAACGAGGCGTCATCCATCATCAATCAGCTGCGGTTGATGGAGTTCTTG
CGAGACATGCAGAAGGAGGAAATCTTCATCCGCTACGTTCACCAGCTGGCTTCCTTCCAGGCCTCGACGGGGAAC
AGTGGCGAGGCCGGTCTGGCTCTGCGGCTACACGCCGATCTCTACGCCTGGGATCCGACGCGGCAGGCTCCGGCC
CTGACGGAGCCCGAGTTCCCGGCGCAGACGCAGTTTGAGCGCAAGGAACGCATCTACTTTGACATGATCAAGCAC
TTTGAGGAAGGCGAGTCGTGGAGCAACGCGCTGGCAGCGTACAAGGAGCTGCAGACGCAGTACGAGAGCAACGTC
TTCGACTTTGCCAAGCTGGCGAGGACGGATCGAGCCATGGCGACGATATACGATAAGATTTCCAAGTGCGACAAG
ATGACGCCGCGATACTTCAAGGTCGTCTACAAGGGCCTGGGCTTCCCGTCGAGTCTCCGGGACAAGGAGTTCGTC
TTTGAGGGATCGCTGGCCGAGCGCGTCTCCGCCTTCAGCGATCGCCTGCAGGAGCAGTTCCCGTCGGCCAAGATG
GTGACGACGGGCGACGTCGATGAGGTCGAGGGGCAGTTCCTCGTTGTCTCGACCATCAGTCCTCACCGCGACTTG
GCTCACCCGGTGTATCAGAGGGCCCGTGTGCCTCAAGTCGTGCGCGACTACATGCTGTGCGCGCATCCTCAGACC
TTCTCCGTCACCAAGAGAAGGCACACGTCAGGACCGGTAGAGGGTCATTACGCGGAGAAGACGATGATGACGACG
TCGGAGCCGTTTCCGACTCTGCTGCGACGGAGCGAGATTGTGGAAACGCAAGAGCTTCGGCTCAACGCTCACGAG
ACTGGGCTGGAGCGCATCGTGCGAAAGACGCAGGAGATGGCAGCCCTGGAGCGTCGCCTGGCAGACGGAGACGGA
GACGGCGCCCAACAGCTACTAGATGCCGTCACCATCGCCGTCAACCCTTCCTCGGAGCACAGCGTCGTCTGCTAC
CGAGCCCTGATAGCGGAACCGGGCCGAGACGAGGATGAGGAGGCGGTCGAGGAGGCGGAGCTCGAGCCTCAGGAG
ACGGCCCTGCGGATGGCGCTGATGGACCATGCCCTGGTCATCAAGAAGTGCTTGGCCACGTTTGCCCGAAGCGCC
AACGAGGTGCTTCTTCGGAAGCAAGAGGAACTCAGTCTCCGTAAGTTGACCTTTATAGCAGCCCTGGGCGTTTTA
AAAAAAAAAAGGAAGGGGGGACTCGTTCTTAACTGGTGATGAAGGCTTCGAGGACACGTTCGAGCAAGAGATTGC
CACATTCACCCCGCCGCCGCCTCCCGTGCCGCGCGAGGCGACGCCGACGCCGTCCACGGCCTTTAGGGGCTCTCT
CCCTCCGGACAAGCGGTCTCAGTGGCCAAAGACGGCGAGCCCGCTGAACGGAGGCGCCAAAGCGGAAGAGACGGC
CGTCGTGCAGCGGGTGTCGACGCGGCATCGCGGTGCGAGACTGAGCTTCCTCAGCGGACGGAAGCCCGAAGCCGA
GCAGGCTGCCGAGGCGGACAGGCCCAACGGCGGCACCGACGCGACGAGCTCTCCCAGAGTCAGCGTCAGCAAGGC
GTCGGGCCTGCGGCACAGCATCTTCCGGTCACAGTCGATGAACGAGGGCGGCGATGACCAGGGCGTCGGGCTGAG
GCAGCGGAGCGGCTCGGCAGGCAAGGAGAGTCTCGATGGCGGGTTGGCGGCGGACGGGGGACAGACGGTTGATAA
GGAGGAGCCTACGCTCACGAAGCGGGGGAGTATGAGGAAGAGGCTCAGCAAGTTGAATGTGAAGCTGGGGAAGAA
GGGGGCCAAGGGGGGTTGGGCTATGGGGAGTCTGAATGAGGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail