Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05723
Gene name
Locationscaffold_06:2113434..2116743
Strand+
Gene length (bp)3309
Transcript length (bp)2118
Coding sequence length (bp)2118
Protein length (aa) 706

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 4.8E-104 156 595
PF07690 MFS_1 Major Facilitator Superfamily 1.9E-23 159 512

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

Domain # Start End Length
1 149 171 22
2 191 212 21
3 224 246 22
4 312 334 22
5 399 421 22
6 436 458 22
7 465 487 22
8 497 519 22
9 559 581 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 73.27 41.30 105.24
Alive In ants, during behavior modification 137.86 67.33 208.39
Dead In ants, recently dead 95.90 52.47 139.34

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.001226 yes
Alive Dead 0.041630 yes
Dead Fungus 0.169553 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05723
MSPRTPTISSSSRPRLPSNIPLRTLAATAAAAASDDAPSPRLSESESESSWTDTGDIGDQLADDNDPVRLQLPDD
IEDELLARVQKRHQKRVRIRHPSPRRSPLLPCVVDKEAIDIPDVICPRPSFAERCIAAAMSGRSGSIHGLTGKAL
LYFTSIFVSLGVFLFGYDQGVMSGIITGPYFIDYFDHPSKAHVGTMVAILEIGAFIASLIVGRVGDIIGRRRTIL
YGSCIFFVGGALQTFSTSMAMMMVGRIVAGLGVGMLSTIVPVYQSEISPPHNRGKLACIEFSGNIIGYTTSVWVD
YGCGFIESDLSWRVPLLMQCVMGALLGLGSLIIVESPRWLLDNDHDEEGMVVIANLYGGGDIHNAKARDEYRDIK
MNVLLQRQEGERTYSDMFRRYRTRVFIAMSAQGLAQLNGINVISYYAPYVFESAGWVGHDAVLMTGLNGITYFLS
TIPPWYLVDRWGRRAILLSGAIAMAISLSLISYFIYLDIRWTPRLVVLFVMIYNAAFGYSWGPVPWLYPPEILPL
SIRSKGASLSTATNWAANWLVGEMTPILQEWIKWRLYLVHAFFCVVSFVIVYFIYPETCGVRLEDMDSLFGDAST
IVGTPSIRAETGSLVRGGSPIGSGRGIIGSSAIPGLSLAPGSEMDDDNKSPTHPSGGAGAGAGEDRSVGGWLSRV
VGGRGRADSAGSGQGRYAPLGQEEGSRHGN*
Coding >Ophcf2|05723
ATGTCCCCCAGAACGCCCACCATTTCTTCCTCAAGCCGGCCTCGTCTTCCTTCCAACATCCCTCTGCGGACTCTC
GCCGCCACCGCCGCCGCCGCCGCCTCCGACGACGCCCCATCGCCTCGCCTGTCCGAGTCCGAGTCCGAGTCCTCG
TGGACCGACACGGGCGACATCGGCGACCAGCTCGCCGACGATAACGACCCGGTCCGTCTGCAGCTGCCCGACGAC
ATCGAGGACGAGCTCCTCGCCCGTGTTCAGAAGCGTCATCAGAAACGAGTCCGCATCCGTCATCCCTCGCCTCGA
CGCTCGCCCTTGCTGCCTTGCGTCGTCGACAAGGAAGCCATTGACATCCCCGACGTCATCTGTCCTCGACCCTCC
TTTGCTGAGCGTTGCATCGCCGCCGCCATGTCCGGACGTTCGGGCTCCATACACGGCCTGACGGGCAAGGCCCTG
CTCTACTTCACCAGCATATTCGTCTCCCTCGGCGTCTTCCTCTTCGGCTATGATCAGGGCGTCATGTCGGGCATC
ATCACGGGTCCCTACTTCATCGACTACTTCGACCACCCGTCCAAGGCCCACGTCGGCACAATGGTCGCCATCCTC
GAGATAGGCGCCTTCATCGCCTCCCTCATCGTCGGCCGTGTCGGTGACATCATCGGCCGACGACGAACCATCCTC
TATGGATCCTGCATCTTCTTCGTCGGCGGCGCCCTCCAGACCTTTTCCACCTCGATGGCCATGATGATGGTCGGC
CGCATCGTTGCCGGCCTCGGCGTTGGCATGCTCTCCACCATCGTCCCCGTCTACCAGTCCGAGATATCGCCCCCT
CATAACCGCGGCAAGCTGGCCTGCATCGAGTTCTCCGGCAACATCATCGGCTACACCACCTCAGTCTGGGTCGAC
TACGGCTGCGGCTTCATCGAGAGCGACTTGTCATGGCGCGTGCCGCTACTTATGCAATGCGTCATGGGCGCCCTC
TTAGGCCTGGGCAGCCTCATCATCGTTGAGTCTCCGAGGTGGCTCCTCGACAACGATCACGATGAGGAGGGCATG
GTTGTCATCGCCAATCTCTACGGCGGCGGAGACATTCACAACGCAAAGGCCCGCGACGAATACCGTGACATCAAG
ATGAATGTGCTCCTCCAGCGCCAGGAGGGTGAGCGCACCTACTCGGACATGTTCCGCCGATACCGAACCCGCGTC
TTCATTGCAATGTCCGCCCAGGGCCTGGCCCAGCTCAACGGCATCAACGTCATCTCCTACTACGCCCCCTACGTC
TTCGAGTCGGCCGGCTGGGTCGGGCATGACGCCGTACTCATGACGGGCCTCAACGGCATCACCTACTTTCTCTCC
ACCATACCGCCTTGGTACCTCGTTGATCGCTGGGGACGACGGGCCATTCTCCTCTCGGGCGCCATCGCCATGGCC
ATATCTCTCTCCCTCATCTCTTACTTCATCTACCTCGACATCCGGTGGACGCCGCGGCTGGTGGTGTTGTTCGTC
ATGATCTACAACGCCGCCTTTGGCTACTCGTGGGGGCCCGTCCCCTGGCTCTACCCACCCGAGATCCTGCCGCTG
AGCATCCGGTCCAAGGGCGCCAGCCTGTCGACGGCCACCAACTGGGCCGCCAACTGGCTCGTGGGCGAGATGACG
CCCATACTGCAGGAGTGGATCAAGTGGCGGCTCTACCTCGTCCACGCCTTCTTTTGCGTCGTCAGCTTCGTCATC
GTGTACTTTATATATCCCGAGACGTGCGGCGTCCGGCTCGAAGACATGGATTCGCTCTTCGGCGACGCCAGCACC
ATCGTCGGCACGCCCTCTATCCGGGCCGAGACGGGCTCGCTGGTGCGCGGCGGCTCGCCTATCGGGTCCGGCCGC
GGCATCATCGGCTCGTCCGCCATACCGGGCCTGTCGCTGGCGCCGGGCTCCGAGATGGACGACGATAATAAGTCG
CCGACGCACCCCAGCGGCGGCGCCGGCGCCGGGGCCGGCGAGGACCGATCCGTCGGCGGCTGGCTGTCGAGGGTC
GTGGGAGGCCGGGGCCGCGCGGACAGCGCAGGTAGCGGTCAGGGCCGATACGCGCCTCTCGGCCAAGAGGAGGGC
AGCCGCCACGGGAACTGA
Transcript >Ophcf2|05723
ATGTCCCCCAGAACGCCCACCATTTCTTCCTCAAGCCGGCCTCGTCTTCCTTCCAACATCCCTCTGCGGACTCTC
GCCGCCACCGCCGCCGCCGCCGCCTCCGACGACGCCCCATCGCCTCGCCTGTCCGAGTCCGAGTCCGAGTCCTCG
TGGACCGACACGGGCGACATCGGCGACCAGCTCGCCGACGATAACGACCCGGTCCGTCTGCAGCTGCCCGACGAC
ATCGAGGACGAGCTCCTCGCCCGTGTTCAGAAGCGTCATCAGAAACGAGTCCGCATCCGTCATCCCTCGCCTCGA
CGCTCGCCCTTGCTGCCTTGCGTCGTCGACAAGGAAGCCATTGACATCCCCGACGTCATCTGTCCTCGACCCTCC
TTTGCTGAGCGTTGCATCGCCGCCGCCATGTCCGGACGTTCGGGCTCCATACACGGCCTGACGGGCAAGGCCCTG
CTCTACTTCACCAGCATATTCGTCTCCCTCGGCGTCTTCCTCTTCGGCTATGATCAGGGCGTCATGTCGGGCATC
ATCACGGGTCCCTACTTCATCGACTACTTCGACCACCCGTCCAAGGCCCACGTCGGCACAATGGTCGCCATCCTC
GAGATAGGCGCCTTCATCGCCTCCCTCATCGTCGGCCGTGTCGGTGACATCATCGGCCGACGACGAACCATCCTC
TATGGATCCTGCATCTTCTTCGTCGGCGGCGCCCTCCAGACCTTTTCCACCTCGATGGCCATGATGATGGTCGGC
CGCATCGTTGCCGGCCTCGGCGTTGGCATGCTCTCCACCATCGTCCCCGTCTACCAGTCCGAGATATCGCCCCCT
CATAACCGCGGCAAGCTGGCCTGCATCGAGTTCTCCGGCAACATCATCGGCTACACCACCTCAGTCTGGGTCGAC
TACGGCTGCGGCTTCATCGAGAGCGACTTGTCATGGCGCGTGCCGCTACTTATGCAATGCGTCATGGGCGCCCTC
TTAGGCCTGGGCAGCCTCATCATCGTTGAGTCTCCGAGGTGGCTCCTCGACAACGATCACGATGAGGAGGGCATG
GTTGTCATCGCCAATCTCTACGGCGGCGGAGACATTCACAACGCAAAGGCCCGCGACGAATACCGTGACATCAAG
ATGAATGTGCTCCTCCAGCGCCAGGAGGGTGAGCGCACCTACTCGGACATGTTCCGCCGATACCGAACCCGCGTC
TTCATTGCAATGTCCGCCCAGGGCCTGGCCCAGCTCAACGGCATCAACGTCATCTCCTACTACGCCCCCTACGTC
TTCGAGTCGGCCGGCTGGGTCGGGCATGACGCCGTACTCATGACGGGCCTCAACGGCATCACCTACTTTCTCTCC
ACCATACCGCCTTGGTACCTCGTTGATCGCTGGGGACGACGGGCCATTCTCCTCTCGGGCGCCATCGCCATGGCC
ATATCTCTCTCCCTCATCTCTTACTTCATCTACCTCGACATCCGGTGGACGCCGCGGCTGGTGGTGTTGTTCGTC
ATGATCTACAACGCCGCCTTTGGCTACTCGTGGGGGCCCGTCCCCTGGCTCTACCCACCCGAGATCCTGCCGCTG
AGCATCCGGTCCAAGGGCGCCAGCCTGTCGACGGCCACCAACTGGGCCGCCAACTGGCTCGTGGGCGAGATGACG
CCCATACTGCAGGAGTGGATCAAGTGGCGGCTCTACCTCGTCCACGCCTTCTTTTGCGTCGTCAGCTTCGTCATC
GTGTACTTTATATATCCCGAGACGTGCGGCGTCCGGCTCGAAGACATGGATTCGCTCTTCGGCGACGCCAGCACC
ATCGTCGGCACGCCCTCTATCCGGGCCGAGACGGGCTCGCTGGTGCGCGGCGGCTCGCCTATCGGGTCCGGCCGC
GGCATCATCGGCTCGTCCGCCATACCGGGCCTGTCGCTGGCGCCGGGCTCCGAGATGGACGACGATAATAAGTCG
CCGACGCACCCCAGCGGCGGCGCCGGCGCCGGGGCCGGCGAGGACCGATCCGTCGGCGGCTGGCTGTCGAGGGTC
GTGGGAGGCCGGGGCCGCGCGGACAGCGCAGGTAGCGGTCAGGGCCGATACGCGCCTCTCGGCCAAGAGGAGGGC
AGCCGCCACGGGAACTGA
Gene >Ophcf2|05723
ATGTGTTCGTAGTACTATGTAGGTATGTATGAATACACGGTCAGGCTACCATCGATCATGGTCAGACTCGTGCCC
CGCAATCGATTGTTTGTTTGCTGTCGTCACGCTGCCCTTCGGATCCGGATTGTCGGTTGATGGATGAGTGACGAG
GTCAGTCAGACAACGATGCATACATACATGCCTGCACGTGAGGCCCGACGTGGCTGTCTGCACGAGGCCCGCCCC
GGATATCTACCTAGGTGCCTACCTACCTACCTACTTATGTACCTTCCTACCCTACGGCCCGCGTGAATCCAGCCC
GACGACTGCGTGCGACCCTCCCCCTAGCCGGCCAGACTCTAGGCCGAGGGCGGCAGAGGCTGGACGGGCGGCTTA
GCACATGCCCGACCGCTACCACCACTATGGACCACCACGGCCACTAGGTACTACAGGCGGTAGCCTCTGCCCCTG
GGCCCCTATTTCCAGCCGGGATGGAGTGGACAGCACGAAAACACCACGAAAACACCACTGCCCTTCCATCAGCCT
CACTCATCATCATCAATATCCCACCGTCAATCGATCCTCTTCACCTTCGCTCTCCGCCTTCCGCTGTTCGTCCGT
CACCTGCCCGCTCCCTCACCCTTGCAATTGAACCTCTCTCTCTTGTCTGCTGGTAGCGCCTCTGCCTCCCCCCCC
TTCCGTTCGGCCCTCTCCGGACGCTAGCCAACATTCGGTCACCGTCACAGTGTTTCGCCTCGCCATCGCCGTTTG
TGTTTTGTCACAACTCTGCTGGTCTGCTGTCCACCTACAACAGCCTACTCTCTACTGCAAAGAGCCGTCAGCCGA
CCGTGCCGAGCCACACGGCCAAGCTTGGCCCAAACTCTCCCCCACACCCATCGCCGACCGCCAGAACCTCGCCGC
CTCCCGTCTCGCCTCCGTCTCTCCTTGAAAGCAGGCGGGCGCTGCTGCTCAACAGCCCCCAGAACGCCCACCATT
TCTTCCTCAAGCCGGCCTCGTCTTCCTTCCAACATCCCTCTGCGGACTCTCGCCGCCACCGCCGCCGCCGCCGCC
TCCGACGACGCCCCATCGCCTCGCCTGTCCGAGTCCGAGTCCGAGTCCTCGTGGACCGACACGGGCGACATCGGC
GACCAGCTCGCCGACGATAACGACCCGGTCCGTCTGCAGCTGCCCGACGACATCGAGGACGAGCTCCTCGCCCGT
GTTCAGAAGCGTCATCAGAAACGAGTCCGCATCCGTCATCCCTCGCCTCGACGCTCGCCCTTGCTGCCTTGCGTC
GTCGACAAGGAAGCCATTGACATCCCCGACGTCATCTGTCCTCGACCCTCCTTTGCTGAGCGTTGCATCGCCGCC
GCCATGTCCGGACGTTCGGGCTCCATACACGGCCTGACGGGCAAGGCCCTGCTGTAACGCTCTCTAGTACAGACT
CCCGCACGAGACGGGCCGCTGACGGCTCGCCAGCTACTTCACCAGCATATTCGTCTCCCTCGGCGTCTTCCTCTT
CGGCTATGATCAGGGCGTCATGTCGGGCATCATCACGTATGTACTGCGAGCTCTCCCCTCCCCCCCCCCCCCCCC
CAATCAGGCCCCCATCGGGCCCTGGAGCTAAAGCCACCAAGGGGTCCCTACTTCATCGACTACTTCGACCACCCG
TCCAAGGCCCACGTCGGCACAATGGTCGCCATCCTCGAGATAGGCGCCTTCATCGCCTCCCTCATCGTCGGCCGT
GTCGGTGACATCATCGGCCGACGACGAACCATCCTCTATGGATCCTGCATCTTCTTCGTCGGCGGCGCCCTCCAG
ACCTTTTCCACCTCGATGGCCATGATGATGGTCGGCCGCATCGTTGCCGGCCTCGGCGTTGGCATGCTCTCCACC
ATCGTCCCCGTCTACCAGTCCGAGATATCGCCCCCTCATAACCGCGGCAAGCTGGCCTGCATCGAGTTCTCCGGC
AACATCATCGGCTACACCACCTCAGTCTGGGTCGACTACGGCTGCGGCTTCATCGAGAGCGACTTGTCATGGCGC
GTGCCGCTACTTATGCAATGCGTCATGGGCGCCCTCTTAGGCCTGGGCAGCCTCATCATCGTTGAGTCTCCGAGG
TGAGTCCGTCATCTGGCCTGTCACGTGTGCCTGCTAACCTTGTCCAGGTGGCTCCTCGACAACGATCACGATGAG
GAGGGCATGGTTGTCATCGCCAATCTCTACGGCGGCGGAGACATTCACAACGCAAAGGCCCGCGACGAATACCGT
GACATCAAGATGAATGTGCTCCTCCAGCGCCAGGAGGGTGAGCGCACCTACTCGGACATGTTCCGCCGATACCGA
ACCCGCGTCTTCATTGCAATGTCCGCCCAGGGCCTGGCCCAGCTCAACGGCATCAACGTCATCTCCTACTACGCC
CCCTACGTCTTCGAGTCGGCCGGCTGGGTCGGGCATGACGCCGTACTCATGACGGGCCTCAACGGCATCACCTAC
TTTCTCTCCACCATACCGCCTTGGTACCTCGTTGATCGCTGGGGACGACGGGCCATTCTCCTCTCGGGCGCCATC
GCCATGGCCATATCTCTCTCCCTCATCTCTTACTTCATCTACCTCGACATCCGGTGGACGCCGCGGCTGGTGGTG
TTGTTCGTCATGATCTACAACGCCGCCTTTGGCTACTCGTGGGGGCCCGTCCCCTGGCTCTACCCACCCGAGATC
CTGCCGCTGAGCATCCGGTCCAAGGGCGCCAGCCTGTCGACGGCCACCAACTGGGCCGCCAACTGGCTCGTGGGC
GAGATGACGCCCATACTGCAGGAGTGGATCAAGTGGCGGCTCTACCTCGTCCACGCCTTCTTTTGCGTCGTCAGC
TTCGTCATCGGTAAGTCTTGAGCCAGCGGGTGTAGATGCGCGAGACTGCTGACGTTGGGGGACGCAGTGTACTTT
ATATATCCCGAGACGTGCGGCGTCCGGCTCGAAGACATGGATTCGCTCTTCGGCGACGCCAGCACCATCGTCGGC
ACGCCCTCTATCCGGGCCGAGACGGGCTCGCTGGTGCGCGGCGGCTCGCCTATCGGGTCCGGCCGCGGCATCATC
GGCTCGTCCGCCATACCGGGCCTGTCGCTGGCGCCGGGCTCCGAGATGGACGACGATAATAAGTCGCCGACGCAC
CCCAGCGGCGGCGCCGGCGCCGGGGCCGGCGAGGACCGATCCGTCGGCGGCTGGCTGTCGAGGGTCGTGGGAGGC
CGGGGCCGCGCGGACAGCGCAGGTAGCGGTCAGGGCCGATACGCGCCTCTCGGCCAAGAGGAGGGCAGCCGCCAC
GGGAACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail