Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05713
Gene name
Locationscaffold_06:2078740..2081005
Strand+
Gene length (bp)2265
Transcript length (bp)2124
Coding sequence length (bp)2124
Protein length (aa) 708

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 1.5E-34 446 635

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.6155 0.387 0.0609 0.4568 0.0474 0.0118 0.1274 0.2377 0.3793 0.0166

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3089
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|495
Ophiocordyceps australis map64 (Brazil) OphauB2|2359
Ophiocordyceps camponoti-floridani Ophcf2|05713 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6828
Ophiocordyceps kimflemingae Ophio5|6790
Ophiocordyceps subramaniannii Hirsu2|5376

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05713
MVPSRVSSLRSKRRASMRATAFRDEVSLVALRYEKTKAASPPVPLPPTRSLPRASSTSRSSLSSSSSPGHSPVVV
VAPMPPAEQHPALRCPPAASLADDWKRDSGHAAAAIRDDDEKRGASPSNHGPDTLALSKSASHLVSGRIPTASLG
NHDLMAGLSFSKRGSILLDAASSPPPSPTNKGPDIRVLSADMDMESQKVRSLYESGDGFRWEDGARHSFCDRLEP
MPEVPFEETGNDYSSSKRCASVYSQNRRDTELAGGLEDWEDVDGADVDRYGFISAPRPTSRVSTPTDLWSAQLSP
RRRNVLHKRDPMGFSSNLGGGRIPSRKVSARSLKTQNSEMSAASVRSSRSVLRQAGNLLPGNRNRRWMDEAGDML
TVSPSLQDMMEEAHVDSISDALKRKEWERCEKWRRMAKVLRRSGDDPQGSGFDFDVRSPKLVERTWKGIPDRWRA
AAWWSFLDSAARKRPDSASVDELTAAFQSLQARSSPDDVQIDMDVPRTISRHIMFRRRYRGGQRLLFRVLHAVSL
YFPDTGYVQGMASLAATLLCYFDEEKCFVMLVRMWRLRGLERLYQPGFGGLMTALAEFEDGWLAPEMVEKLSELG
VVTTAYATRWYLTLFNLSMPFAAQLRVWDVFLLLGDDDDDDDDGISGLEMLHATSAALVQALREVLLDADFENAM
KALMSWIPIKDEDLLMKVVKAEWKTHRGRKRT*
Coding >Ophcf2|05713
ATGGTCCCTTCGAGGGTATCGTCGCTGCGGTCCAAGCGACGGGCCAGCATGAGGGCAACGGCCTTTCGCGACGAG
GTCAGCCTCGTGGCGCTCCGATACGAAAAGACAAAGGCCGCGTCGCCTCCTGTGCCTCTGCCGCCCACACGCAGC
CTGCCGCGGGCCTCTAGCACGTCCCGCTCCAGCCTGTCGTCTTCTTCGTCGCCCGGTCACAGCCCAGTCGTCGTC
GTGGCGCCCATGCCGCCAGCCGAACAGCATCCCGCCCTGCGATGTCCGCCTGCCGCCTCGCTGGCTGATGACTGG
AAACGAGACTCGGGCCACGCCGCCGCTGCGATTCGCGACGATGACGAGAAGCGGGGCGCTTCCCCGTCCAATCAT
GGACCCGATACGCTGGCTTTGTCCAAGTCGGCCTCGCACCTGGTCTCCGGTCGCATCCCCACGGCCAGCCTCGGC
AATCATGACTTGATGGCTGGCCTCTCCTTCTCTAAGCGCGGCAGCATCCTGCTCGACGCCGCCTCGTCGCCTCCT
CCGTCGCCCACCAACAAGGGACCCGACATTCGCGTGCTGTCCGCCGACATGGACATGGAGTCGCAAAAGGTGAGG
TCGCTCTACGAGTCGGGAGACGGCTTCAGGTGGGAGGACGGCGCGAGGCACTCGTTTTGCGACCGCCTCGAGCCC
ATGCCCGAGGTTCCGTTTGAGGAGACGGGCAATGACTACTCCTCGTCCAAGAGGTGCGCCAGCGTCTACTCCCAG
AACAGACGCGACACGGAGCTCGCCGGCGGTCTCGAGGACTGGGAAGATGTTGACGGCGCCGACGTCGACCGTTAC
GGCTTCATCAGCGCTCCGCGTCCGACTTCGAGGGTCAGCACCCCGACGGACCTCTGGTCGGCCCAGCTGTCGCCC
AGGAGGCGCAATGTGCTACACAAGCGTGATCCCATGGGTTTCTCTTCCAACCTGGGCGGCGGTCGGATCCCCAGC
CGCAAGGTGTCGGCCCGGTCTCTCAAGACACAAAACTCGGAGATGTCGGCGGCGTCGGTCCGTTCGTCGCGCTCG
GTCCTGCGCCAGGCTGGCAACCTGCTGCCCGGAAACCGCAATAGGCGCTGGATGGACGAAGCGGGCGACATGCTG
ACGGTTTCGCCCAGTCTCCAAGACATGATGGAGGAGGCGCACGTCGACAGCATCTCCGACGCCCTCAAGCGCAAA
GAATGGGAGCGGTGCGAGAAGTGGCGCCGCATGGCCAAGGTGCTGCGCCGTTCCGGCGACGATCCTCAGGGCTCC
GGCTTCGACTTTGACGTCCGGAGCCCCAAGCTGGTGGAGCGGACGTGGAAGGGAATCCCCGACCGGTGGCGCGCC
GCCGCCTGGTGGTCCTTTCTAGACTCGGCGGCCCGGAAGAGACCCGACTCGGCTTCGGTGGACGAGCTGACGGCG
GCCTTTCAGTCGCTCCAGGCGCGGAGCTCTCCCGACGACGTGCAGATCGACATGGACGTGCCGCGCACCATCAGC
CGCCACATCATGTTCCGGAGACGGTATCGCGGCGGTCAGCGGCTGCTGTTCCGCGTCCTGCACGCCGTCTCTCTC
TACTTTCCGGACACGGGCTACGTGCAGGGCATGGCATCGCTGGCGGCGACGCTGTTGTGCTACTTTGACGAGGAG
AAGTGCTTCGTGATGCTGGTGCGGATGTGGAGGCTGCGCGGGCTGGAACGCCTGTATCAACCGGGCTTCGGGGGG
CTGATGACGGCGCTGGCCGAGTTTGAAGACGGCTGGCTGGCTCCGGAGATGGTTGAGAAGCTGTCGGAGCTCGGG
GTGGTGACGACGGCGTACGCGACGCGCTGGTACCTGACGCTCTTCAACCTGTCGATGCCCTTTGCCGCCCAGCTG
CGCGTATGGGACGTGTTTTTGCTGCTCGGAGACGACGACGATGACGACGACGACGGCATCAGCGGGTTAGAGATG
CTTCACGCGACGTCTGCGGCGCTGGTTCAGGCGCTGCGCGAGGTTCTGCTCGATGCCGACTTTGAGAACGCCATG
AAGGCGCTCATGTCTTGGATCCCCATCAAGGACGAGGACCTCCTGATGAAGGTGGTCAAGGCCGAGTGGAAGACG
CACCGGGGGCGCAAGAGGACCTAG
Transcript >Ophcf2|05713
ATGGTCCCTTCGAGGGTATCGTCGCTGCGGTCCAAGCGACGGGCCAGCATGAGGGCAACGGCCTTTCGCGACGAG
GTCAGCCTCGTGGCGCTCCGATACGAAAAGACAAAGGCCGCGTCGCCTCCTGTGCCTCTGCCGCCCACACGCAGC
CTGCCGCGGGCCTCTAGCACGTCCCGCTCCAGCCTGTCGTCTTCTTCGTCGCCCGGTCACAGCCCAGTCGTCGTC
GTGGCGCCCATGCCGCCAGCCGAACAGCATCCCGCCCTGCGATGTCCGCCTGCCGCCTCGCTGGCTGATGACTGG
AAACGAGACTCGGGCCACGCCGCCGCTGCGATTCGCGACGATGACGAGAAGCGGGGCGCTTCCCCGTCCAATCAT
GGACCCGATACGCTGGCTTTGTCCAAGTCGGCCTCGCACCTGGTCTCCGGTCGCATCCCCACGGCCAGCCTCGGC
AATCATGACTTGATGGCTGGCCTCTCCTTCTCTAAGCGCGGCAGCATCCTGCTCGACGCCGCCTCGTCGCCTCCT
CCGTCGCCCACCAACAAGGGACCCGACATTCGCGTGCTGTCCGCCGACATGGACATGGAGTCGCAAAAGGTGAGG
TCGCTCTACGAGTCGGGAGACGGCTTCAGGTGGGAGGACGGCGCGAGGCACTCGTTTTGCGACCGCCTCGAGCCC
ATGCCCGAGGTTCCGTTTGAGGAGACGGGCAATGACTACTCCTCGTCCAAGAGGTGCGCCAGCGTCTACTCCCAG
AACAGACGCGACACGGAGCTCGCCGGCGGTCTCGAGGACTGGGAAGATGTTGACGGCGCCGACGTCGACCGTTAC
GGCTTCATCAGCGCTCCGCGTCCGACTTCGAGGGTCAGCACCCCGACGGACCTCTGGTCGGCCCAGCTGTCGCCC
AGGAGGCGCAATGTGCTACACAAGCGTGATCCCATGGGTTTCTCTTCCAACCTGGGCGGCGGTCGGATCCCCAGC
CGCAAGGTGTCGGCCCGGTCTCTCAAGACACAAAACTCGGAGATGTCGGCGGCGTCGGTCCGTTCGTCGCGCTCG
GTCCTGCGCCAGGCTGGCAACCTGCTGCCCGGAAACCGCAATAGGCGCTGGATGGACGAAGCGGGCGACATGCTG
ACGGTTTCGCCCAGTCTCCAAGACATGATGGAGGAGGCGCACGTCGACAGCATCTCCGACGCCCTCAAGCGCAAA
GAATGGGAGCGGTGCGAGAAGTGGCGCCGCATGGCCAAGGTGCTGCGCCGTTCCGGCGACGATCCTCAGGGCTCC
GGCTTCGACTTTGACGTCCGGAGCCCCAAGCTGGTGGAGCGGACGTGGAAGGGAATCCCCGACCGGTGGCGCGCC
GCCGCCTGGTGGTCCTTTCTAGACTCGGCGGCCCGGAAGAGACCCGACTCGGCTTCGGTGGACGAGCTGACGGCG
GCCTTTCAGTCGCTCCAGGCGCGGAGCTCTCCCGACGACGTGCAGATCGACATGGACGTGCCGCGCACCATCAGC
CGCCACATCATGTTCCGGAGACGGTATCGCGGCGGTCAGCGGCTGCTGTTCCGCGTCCTGCACGCCGTCTCTCTC
TACTTTCCGGACACGGGCTACGTGCAGGGCATGGCATCGCTGGCGGCGACGCTGTTGTGCTACTTTGACGAGGAG
AAGTGCTTCGTGATGCTGGTGCGGATGTGGAGGCTGCGCGGGCTGGAACGCCTGTATCAACCGGGCTTCGGGGGG
CTGATGACGGCGCTGGCCGAGTTTGAAGACGGCTGGCTGGCTCCGGAGATGGTTGAGAAGCTGTCGGAGCTCGGG
GTGGTGACGACGGCGTACGCGACGCGCTGGTACCTGACGCTCTTCAACCTGTCGATGCCCTTTGCCGCCCAGCTG
CGCGTATGGGACGTGTTTTTGCTGCTCGGAGACGACGACGATGACGACGACGACGGCATCAGCGGGTTAGAGATG
CTTCACGCGACGTCTGCGGCGCTGGTTCAGGCGCTGCGCGAGGTTCTGCTCGATGCCGACTTTGAGAACGCCATG
AAGGCGCTCATGTCTTGGATCCCCATCAAGGACGAGGACCTCCTGATGAAGGTGGTCAAGGCCGAGTGGAAGACG
CACCGGGGGCGCAAGAGGACCTAG
Gene >Ophcf2|05713
ATGGTCCCTTCGAGGGTATCGTCGCTGCGGTCCAAGCGACGGGCCAGCATGAGGGCAACGGCCTTTCGCGACGAG
GTCAGCCTCGTGGCGCTCCGATACGAAAAGACAAAGGCCGCGTCGCCTCCTGTGCCTCTGCCGCCCACACGCAGC
CTGCCGCGGGCCTCTAGCACGTCCCGCTCCAGCCTGTCGTCTTCTTCGTCGCCCGGTCACAGCCCAGTCGTCGTC
GTGGCGCCCATGCCGCCAGCCGAACAGCATCCCGCCCTGCGATGTCCGCCTGCCGCCTCGCTGGCTGATGACTGG
AAACGAGACTCGGGCCACGCCGCCGCTGCGATTCGCGACGATGACGAGAAGCGGGGCGCTTCCCCGTCCAATCAT
GGACCCGATACGCTGGCTTTGTCCAAGTCGGCCTCGCACCTGGTCTCCGGTCGCATCCCCACGGCCAGCCTCGGC
AATCATGACTTGATGGCTGGCCTCTCCTTCTCTAAGCGCGGCAGCATCCTGCTCGACGCCGCCTCGTCGCCTCCT
CCGTCGCCCACCAACAAGGGACCCGACATTCGCGTGCTGTCCGCCGACATGGACATGGAGTCGCAAAAGGTGAGG
TCGCTCTACGAGTCGGGAGACGGCTTCAGGTGGGAGGACGGCGCGAGGCACTCGTTTTGCGACCGCCTCGAGCCC
ATGCCCGAGGTTCCGTTTGAGGAGACGGGCAATGACTACTCGTACGCCGCATGAATCTTTTCTTCCCATGTTTTT
TTTTATTCTTTCTTCCTTTTCTTCTGCTGACGGACGGCAGCTCGTCCAAGAGGTGCGCCAGCGTCTACTCCCAGA
ACAGACGCGACACGGAGCTCGCCGGCGGTCTCGAGGACTGGGAAGATGTTGACGGCGCCGACGTCGACCGTTACG
GCTTCATCAGCGCTCCGCGTCCGACTTCGAGGGTCAGCACCCCGACGGACCTCTGGTCGGCCCAGCTGTCGCCCA
GGAGGCGCAATGTGCTACACAAGCGTGATCCCATGGGTTTCTCTTCCAACCTGGGCGGCGGTCGGATCCCCAGCC
GCAAGGTGTCGGCCCGGTCTCTCAAGACACAAAACTCGGAGATGTCGGCGGCGTCGGTCCGTTCGTCGCGCTCGG
TCCTGCGCCAGGCTGGCAACCTGCTGCCCGGAAACCGCAATAGGCGCTGGATGGACGAAGCGGGCGACATGCTGA
CGGTTTCGCCCAGTCTCCAAGACATGATGGAGGAGGCGCACGTCGACAGCATCTCCGACGCCCTCAAGCGCAAAG
AATGGGAGCGGTGCGAGAAGTGGCGCCGCATGGCCAAGGTGCTGCGCCGTTCCGGCGACGATCCTCAGGGCTCCG
GCTTCGACTTTGACGTCCGGAGCCCCAAGCTGGTGGAGCGGACGTGGAAGGGAATCCCCGACCGGTGGCGCGCCG
CCGCCTGGTGGTCCTTTCTAGACTCGGCGGCCCGGAAGAGACCCGACTCGGCTTCGGTGGACGAGCTGACGGCGG
CCTTTCAGTCGCTCCAGGCGCGGAGCTCTCCCGACGACGTGCAGATCGACATGGACGTGCCGCGCACCATCAGCC
GCCACATCATGTTCCGGAGACGGTATCGCGGCGGTCAGCGGCTGCTGTTCCGCGTCCTGCACGCCGTCTCTCTCT
ACTTTCCGGACACGGGCTACGTGCAGGGCATGGCATCGCTGGCGGCGACGCTGTTGTGCTACTTTGACGAGGAGA
AGTGCTTCGTGATGCTGGTGCGGATGTGGAGGCTGCGCGGGCTGGAACGCCTGTATCAACCGGGCTTCGGGGGGC
TGATGACGGCGCTGGCCGAGTTTGAAGACGGCTGGCTGGCTCCGGAGATGGTTGAGAAGCTGGTTGGTTTGCCTG
CTTCCAGCGTGTCCCAGGCATGAAGAAGAAGTGAAACTGACGAGACCATGGCAGTCGGAGCTCGGGGTGGTGACG
ACGGCGTACGCGACGCGCTGGTACCTGACGCTCTTCAACCTGTCGATGCCCTTTGCCGCCCAGCTGCGCGTATGG
GACGTGTTTTTGCTGCTCGGAGACGACGACGATGACGACGACGACGGCATCAGCGGGTTAGAGATGCTTCACGCG
ACGTCTGCGGCGCTGGTTCAGGCGCTGCGCGAGGTTCTGCTCGATGCCGACTTTGAGAACGCCATGAAGGCGCTC
ATGTCTTGGATCCCCATCAAGGACGAGGACCTCCTGATGAAGGTGGTCAAGGCCGAGTGGAAGACGCACCGGGGG
CGCAAGAGGACCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail