Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05712
Gene name
Locationscaffold_06:2073996..2076632
Strand+
Gene length (bp)2636
Transcript length (bp)2439
Coding sequence length (bp)2439
Protein length (aa) 813

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01843 DIL DIL domain 7.1E-33 538 660
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.9E-08 127 193
PF13637 Ank_4 Ankyrin repeats (many copies) 5.2E-05 173 216
PF00023 Ank Ankyrin repeat 1.4E-04 162 193

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.6819 0.3547 0.1173 0.0628 0.0952 0.0074 0.1363 0.3349 0.6123 0.0091

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1437
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5181
Ophiocordyceps australis map64 (Brazil) OphauB2|2361
Ophiocordyceps camponoti-floridani Ophcf2|05712 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5317
Ophiocordyceps kimflemingae Ophio5|6789
Ophiocordyceps subramaniannii Hirsu2|10961

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05712
MDLGDSTGDTKSPRPMPSDLPTSLDDRRHAPIEGFVPETEMYDGWQGQSQFLTTPALAKPLNFGNLSLNDAAHET
LSADGPTDSDTRLMEMLQAQAAANQAGRGLEDERAVADDEKLSAAEKKDLLQKALSMAASNGDVAKVRRILSGKA
KDYVDVNTPDEDGTPPLIYASCFGHESVVQALIQAGADVNRQDRNQWSALMWTMTNRHKGIAKLLLDNKASSDQK
TSSGRTAFDFVPPDSDMSYYLHNNGYNLGNAGVTDDFYNPGFSQDRFEEEMAENEMRRRLMMESARDLEVDLGNV
GMDDQPEPAEEFEEDQQEFDWSRCLHDQMFVFQENELDRILDIIITKMTPQRSPSQKPVPANMIFLSARYAHYHS
SPELLGRLLVSAMDCINDVVERSQWDMTILAFWLSNATLLLHYLKKDSGLLEATSEFQAQLAELINEIFILIVRD
AERRLDKVLDAAMLDHETIPGFEDITFQNEWKLFKRKTTVREEPPEKRFRPPSPKRRAKPAPRNVTSLLSSSLFV
LDLYDVHSVITAQIVSQLLYWIGAELFNRIMSNRKYLARTKAMQIRMNISILEDWARTNNRQAEHYEGGEMRSSG
DTTTEAARRHLAPSIQLLQWLQCFSSLGPDDLEALVGTLQQLKRLTPQQLMHAATHYRPEVGEKGLPKSALRYLM
AIQKEAALKRDKRRSRAASPLPTSQETAASAAGATTPTKTSNGHGAGANGDGAQDDEEGEDAPEHLLLDPALMLP
FTLPSVTDMLVSYGAGFGGVNRERERKYIPTVPAEFLEKLEVSGVRKEPMFKDKDWENESVE*
Coding >Ophcf2|05712
ATGGACCTGGGCGATTCGACCGGTGACACGAAGTCGCCGCGGCCCATGCCGTCGGATCTGCCCACGTCGCTAGAC
GACCGTCGTCACGCGCCCATCGAGGGCTTCGTGCCTGAAACGGAGATGTACGATGGCTGGCAAGGCCAGTCCCAA
TTCCTGACGACGCCCGCGCTGGCCAAACCCCTCAACTTCGGAAACCTCTCTCTCAACGATGCCGCCCACGAGACG
TTGTCCGCAGACGGCCCCACGGACAGCGACACCAGGCTAATGGAGATGCTACAGGCGCAGGCGGCTGCTAACCAG
GCCGGTCGCGGCCTCGAGGACGAGCGGGCCGTCGCCGACGACGAGAAGCTATCGGCGGCCGAAAAGAAGGATTTG
CTGCAAAAGGCACTGAGCATGGCCGCCAGCAACGGTGACGTCGCAAAGGTCAGGCGCATTCTGAGCGGCAAGGCC
AAGGACTATGTCGACGTCAACACACCAGACGAGGACGGAACGCCGCCTCTCATTTACGCCAGCTGTTTTGGCCAC
GAGAGCGTCGTCCAGGCCCTGATTCAGGCCGGCGCCGACGTAAACAGACAGGACCGCAACCAATGGAGCGCCCTC
ATGTGGACCATGACGAACCGCCACAAGGGCATCGCGAAACTGCTCCTCGACAACAAGGCCTCTTCGGACCAGAAG
ACGTCATCGGGACGGACGGCCTTTGACTTTGTGCCCCCGGACAGCGACATGTCGTACTATCTCCACAACAATGGC
TACAACCTGGGCAACGCGGGCGTCACCGACGACTTTTACAACCCGGGATTCTCACAGGACCGGTTCGAGGAGGAG
ATGGCCGAGAACGAGATGCGGCGGCGGCTCATGATGGAGAGCGCCAGGGACCTCGAGGTCGATCTGGGAAACGTC
GGCATGGATGACCAGCCAGAGCCGGCAGAGGAGTTCGAGGAGGACCAGCAAGAGTTTGACTGGAGCCGGTGTCTG
CACGACCAGATGTTCGTCTTCCAGGAGAACGAGCTCGACCGGATACTCGACATCATCATAACGAAAATGACGCCG
CAGAGGTCGCCCTCGCAGAAGCCGGTGCCGGCCAACATGATCTTTCTCAGCGCGCGATACGCGCACTACCATTCG
AGCCCGGAGCTGCTGGGCCGGCTGCTGGTGTCGGCCATGGACTGCATCAACGACGTGGTGGAGCGGAGCCAGTGG
GACATGACGATCCTGGCCTTTTGGCTATCCAACGCGACGCTGCTGCTGCACTACCTCAAGAAGGATAGCGGGCTG
CTGGAGGCGACGTCGGAGTTCCAGGCGCAGCTGGCGGAGCTCATCAATGAAATCTTCATACTCATCGTGCGCGAC
GCTGAGCGGAGGCTCGACAAGGTGCTGGACGCGGCCATGCTGGACCACGAGACGATACCGGGCTTCGAGGACATC
ACGTTTCAGAACGAGTGGAAGCTGTTTAAGCGCAAGACGACGGTGCGCGAGGAGCCGCCCGAGAAGCGCTTCCGG
CCGCCGTCGCCCAAGCGGCGAGCCAAGCCGGCGCCTCGCAACGTGACGTCGCTGCTGTCGTCGTCGCTCTTCGTG
CTGGACCTGTACGACGTGCACTCGGTGATTACGGCGCAGATCGTCTCGCAGTTACTGTACTGGATAGGAGCGGAG
CTGTTCAACCGCATCATGTCGAACCGCAAGTACCTGGCGCGGACCAAGGCGATGCAGATCCGGATGAACATCTCC
ATCCTCGAGGACTGGGCGCGGACCAACAACCGACAGGCGGAGCACTACGAGGGTGGCGAGATGCGTTCATCGGGC
GACACGACGACGGAGGCGGCAAGGCGGCACCTGGCGCCCAGCATCCAACTGCTGCAGTGGCTACAGTGCTTCTCG
TCGCTGGGGCCGGACGACCTGGAGGCGCTGGTGGGGACGCTGCAGCAGCTCAAGAGGCTGACGCCGCAGCAGCTA
ATGCACGCGGCGACGCACTACCGGCCCGAGGTCGGCGAGAAGGGCTTGCCCAAGAGCGCGCTCAGGTACCTGATG
GCCATCCAGAAGGAGGCGGCGCTGAAGCGGGACAAGCGAAGGAGCCGCGCGGCGTCTCCGCTGCCGACGAGCCAG
GAGACGGCGGCGTCGGCGGCTGGGGCTACGACGCCGACCAAGACGTCCAACGGGCACGGGGCGGGGGCCAACGGA
GACGGGGCGCAGGACGATGAGGAGGGCGAGGACGCGCCGGAGCATCTTCTGTTGGATCCGGCGCTGATGCTGCCC
TTTACGCTGCCGTCGGTGACGGACATGCTGGTCTCGTACGGGGCCGGTTTCGGAGGCGTGAACCGTGAGCGGGAG
CGCAAGTACATACCGACGGTGCCGGCCGAGTTCCTGGAGAAGCTCGAGGTGAGCGGAGTGCGCAAGGAGCCCATG
TTCAAGGACAAGGACTGGGAGAACGAGTCGGTAGAGTAA
Transcript >Ophcf2|05712
ATGGACCTGGGCGATTCGACCGGTGACACGAAGTCGCCGCGGCCCATGCCGTCGGATCTGCCCACGTCGCTAGAC
GACCGTCGTCACGCGCCCATCGAGGGCTTCGTGCCTGAAACGGAGATGTACGATGGCTGGCAAGGCCAGTCCCAA
TTCCTGACGACGCCCGCGCTGGCCAAACCCCTCAACTTCGGAAACCTCTCTCTCAACGATGCCGCCCACGAGACG
TTGTCCGCAGACGGCCCCACGGACAGCGACACCAGGCTAATGGAGATGCTACAGGCGCAGGCGGCTGCTAACCAG
GCCGGTCGCGGCCTCGAGGACGAGCGGGCCGTCGCCGACGACGAGAAGCTATCGGCGGCCGAAAAGAAGGATTTG
CTGCAAAAGGCACTGAGCATGGCCGCCAGCAACGGTGACGTCGCAAAGGTCAGGCGCATTCTGAGCGGCAAGGCC
AAGGACTATGTCGACGTCAACACACCAGACGAGGACGGAACGCCGCCTCTCATTTACGCCAGCTGTTTTGGCCAC
GAGAGCGTCGTCCAGGCCCTGATTCAGGCCGGCGCCGACGTAAACAGACAGGACCGCAACCAATGGAGCGCCCTC
ATGTGGACCATGACGAACCGCCACAAGGGCATCGCGAAACTGCTCCTCGACAACAAGGCCTCTTCGGACCAGAAG
ACGTCATCGGGACGGACGGCCTTTGACTTTGTGCCCCCGGACAGCGACATGTCGTACTATCTCCACAACAATGGC
TACAACCTGGGCAACGCGGGCGTCACCGACGACTTTTACAACCCGGGATTCTCACAGGACCGGTTCGAGGAGGAG
ATGGCCGAGAACGAGATGCGGCGGCGGCTCATGATGGAGAGCGCCAGGGACCTCGAGGTCGATCTGGGAAACGTC
GGCATGGATGACCAGCCAGAGCCGGCAGAGGAGTTCGAGGAGGACCAGCAAGAGTTTGACTGGAGCCGGTGTCTG
CACGACCAGATGTTCGTCTTCCAGGAGAACGAGCTCGACCGGATACTCGACATCATCATAACGAAAATGACGCCG
CAGAGGTCGCCCTCGCAGAAGCCGGTGCCGGCCAACATGATCTTTCTCAGCGCGCGATACGCGCACTACCATTCG
AGCCCGGAGCTGCTGGGCCGGCTGCTGGTGTCGGCCATGGACTGCATCAACGACGTGGTGGAGCGGAGCCAGTGG
GACATGACGATCCTGGCCTTTTGGCTATCCAACGCGACGCTGCTGCTGCACTACCTCAAGAAGGATAGCGGGCTG
CTGGAGGCGACGTCGGAGTTCCAGGCGCAGCTGGCGGAGCTCATCAATGAAATCTTCATACTCATCGTGCGCGAC
GCTGAGCGGAGGCTCGACAAGGTGCTGGACGCGGCCATGCTGGACCACGAGACGATACCGGGCTTCGAGGACATC
ACGTTTCAGAACGAGTGGAAGCTGTTTAAGCGCAAGACGACGGTGCGCGAGGAGCCGCCCGAGAAGCGCTTCCGG
CCGCCGTCGCCCAAGCGGCGAGCCAAGCCGGCGCCTCGCAACGTGACGTCGCTGCTGTCGTCGTCGCTCTTCGTG
CTGGACCTGTACGACGTGCACTCGGTGATTACGGCGCAGATCGTCTCGCAGTTACTGTACTGGATAGGAGCGGAG
CTGTTCAACCGCATCATGTCGAACCGCAAGTACCTGGCGCGGACCAAGGCGATGCAGATCCGGATGAACATCTCC
ATCCTCGAGGACTGGGCGCGGACCAACAACCGACAGGCGGAGCACTACGAGGGTGGCGAGATGCGTTCATCGGGC
GACACGACGACGGAGGCGGCAAGGCGGCACCTGGCGCCCAGCATCCAACTGCTGCAGTGGCTACAGTGCTTCTCG
TCGCTGGGGCCGGACGACCTGGAGGCGCTGGTGGGGACGCTGCAGCAGCTCAAGAGGCTGACGCCGCAGCAGCTA
ATGCACGCGGCGACGCACTACCGGCCCGAGGTCGGCGAGAAGGGCTTGCCCAAGAGCGCGCTCAGGTACCTGATG
GCCATCCAGAAGGAGGCGGCGCTGAAGCGGGACAAGCGAAGGAGCCGCGCGGCGTCTCCGCTGCCGACGAGCCAG
GAGACGGCGGCGTCGGCGGCTGGGGCTACGACGCCGACCAAGACGTCCAACGGGCACGGGGCGGGGGCCAACGGA
GACGGGGCGCAGGACGATGAGGAGGGCGAGGACGCGCCGGAGCATCTTCTGTTGGATCCGGCGCTGATGCTGCCC
TTTACGCTGCCGTCGGTGACGGACATGCTGGTCTCGTACGGGGCCGGTTTCGGAGGCGTGAACCGTGAGCGGGAG
CGCAAGTACATACCGACGGTGCCGGCCGAGTTCCTGGAGAAGCTCGAGGTGAGCGGAGTGCGCAAGGAGCCCATG
TTCAAGGACAAGGACTGGGAGAACGAGTCGGTAGAGTAA
Gene >Ophcf2|05712
ATGGACCTGGGCGATTCGACCGGTGACACGAAGTCGCCGCGGCCCATGCCGTCGGATCTGCCCACGTCGCTAGAC
GACCGTCGTCACGCGCCCATCGAGGGCTTCGTGCCTGAAACGGAGATGTACGATGGCTGGCAAGGTCTGTATCCT
CCTTTCCGCTGCGTTGCCTTGGAACGTACTGATCGAGTCTCCTCCTGTTGCCTGCGCGCTCAGGCCAGTCCCAAT
TCCTGACGACGCCCGCGCTGGCCAAACCCCTCAACTTCGGAAACCTCTCTCTCAACGATGCCGCCCACGAGACGT
TGTCCGCAGACGGCCCCACGGACAGCGACACCAGGCTAATGGAGATGCTACAGGCGCAGGCGGCTGCTAACCAGG
CCGGTCGCGGCCTCGAGGACGAGCGGGCCGTCGCCGACGACGAGAAGCTATCGGCGGCCGAAAAGAAGGATTTGC
TGCAAAAGGCACTGAGCATGGCCGCCAGCAACGGTGACGTCGCAAAGGTCAGGCGCATTCTGAGCGGCAAGGCCA
AGGACTATGTCGACGTCAACACACCAGACGAGGACGGAACGCCGCCTCTCATTTACGCCAGCTGTTTTGTGAGTC
GTGCTCTTGTGGACCGTCGTCTGTCCCCACACTCACCTTCCCACCCCTTTATGCAGGGCCACGAGAGCGTCGTCC
AGGCCCTGATTCAGGCCGGCGCCGACGTAAACAGACAGGACCGCAACCAATGGAGCGCCCTCATGTGGACCATGA
CGAACCGCCACAAGGGCATCGCGAAACTGCTCCTCGACAACAAGGCCTCTTCGGACCAGAAGACGTCATCGGGAC
GGACGGCCTTTGACTTTGTGCCCCCGGACAGCGACATGTCGTACTATCTCCACAACAATGGCTACAACCTGGGCA
ACGCGGGCGTCACCGACGACTTTTACAACCCGGGATTCTCACAGGACCGGTTCGAGGAGGAGATGGCCGAGAACG
AGATGCGGCGGCGGCTCATGATGGAGAGCGCCAGGGACCTCGAGGTCGATCTGGGAAACGTCGGCATGGATGACC
AGCCAGAGGTTGGTTGGCCCACCAGCATCACCGGGGTCGAGACGTGGCTGACGATTGGCGAGGAACAGCCGGCAG
AGGAGTTCGAGGAGGACCAGCAAGAGTTTGACTGGAGCCGGTGTCTGCACGACCAGATGTTCGTCTTCCAGGAGA
ACGAGCTCGACCGGATACTCGACATCATCATAACGAAAATGACGCCGCAGAGGTCGCCCTCGCAGAAGCCGGTGC
CGGCCAACATGATCTTTCTCAGCGCGCGATACGCGCACTACCATTCGAGCCCGGAGCTGCTGGGCCGGCTGCTGG
TGTCGGCCATGGACTGCATCAACGACGTGGTGGAGCGGAGCCAGTGGGACATGACGATCCTGGCCTTTTGGCTAT
CCAACGCGACGCTGCTGCTGCACTACCTCAAGAAGGATAGCGGGCTGCTGGAGGCGACGTCGGAGTTCCAGGCGC
AGCTGGCGGAGCTCATCAATGAAATCTTCATACTCATCGTGCGCGACGCTGAGCGGAGGCTCGACAAGGTGCTGG
ACGCGGCCATGCTGGACCACGAGACGATACCGGGCTTCGAGGACATCACGTTTCAGAACGAGTGGAAGCTGTTTA
AGCGCAAGACGACGGTGCGCGAGGAGCCGCCCGAGAAGCGCTTCCGGCCGCCGTCGCCCAAGCGGCGAGCCAAGC
CGGCGCCTCGCAACGTGACGTCGCTGCTGTCGTCGTCGCTCTTCGTGCTGGACCTGTACGACGTGCACTCGGTGA
TTACGGCGCAGATCGTCTCGCAGTTACTGTACTGGATAGGAGCGGAGCTGTTCAACCGCATCATGTCGAACCGCA
AGTACCTGGCGCGGACCAAGGCGATGCAGATCCGGATGAACATCTCCATCCTCGAGGACTGGGCGCGGACCAACA
ACCGACAGGCGGAGCACTACGAGGGTGGCGAGATGCGTTCATCGGGCGACACGACGACGGAGGCGGCAAGGCGGC
ACCTGGCGCCCAGCATCCAACTGCTGCAGTGGCTACAGTGCTTCTCGTCGCTGGGGCCGGACGACCTGGAGGCGC
TGGTGGGGACGCTGCAGCAGCTCAAGAGGCTGACGCCGCAGCAGCTAATGCACGCGGCGACGCACTACCGGCCCG
AGGTCGGCGAGAAGGGCTTGCCCAAGAGCGCGCTCAGGTACCTGATGGCCATCCAGAAGGAGGCGGCGCTGAAGC
GGGACAAGCGAAGGAGCCGCGCGGCGTCTCCGCTGCCGACGAGCCAGGAGACGGCGGCGTCGGCGGCTGGGGCTA
CGACGCCGACCAAGACGTCCAACGGGCACGGGGCGGGGGCCAACGGAGACGGGGCGCAGGACGATGAGGAGGGCG
AGGACGCGCCGGAGCATCTTCTGTTGGATCCGGCGCTGATGCTGCCCTTTACGCTGCCGTCGGTGACGGACATGC
TGGTCTCGTACGGGGCCGGTTTCGGAGGCGTGAACCGTGAGCGGGAGCGCAAGTACATACCGACGGTGCCGGCCG
AGTTCCTGGAGAAGCTCGAGGTGAGCGGAGTGCGCAAGGAGCCCATGTTCAAGGACAAGGACTGGGAGAACGAGT
CGGTAGAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail