Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05710
Gene name
Locationscaffold_06:2070759..2071592
Strand-
Gene length (bp)833
Transcript length (bp)765
Coding sequence length (bp)765
Protein length (aa) 255

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03188 Cytochrom_B561 Eukaryotic cytochrome b561 2.5E-16 77 206

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 44 66 22
2 71 93 22
3 114 131 17
4 146 168 22
5 188 207 19
6 212 234 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05710
MASATGMPARAEAGGPEPSDTEPLLGRPGDVIQRRDTSFPRNLIMGTASLAQLGAVLGLILVWASVFNKPLILFS
AHPLLQSLAVFTLIQSVLSLQPTHTAEQKRLGQRVHASLNLVALLLLIAGVTIIEYNKLSSHGPHFHSVHGYLGV
IVSIIIIMQYLVGFTMWAVPALYGGEVRARSVWKYHRYSGYVVLLLLLVTVCSATETDYNRNVLHMKLWATVLAS
ILVVVGVFPRIQKYKLGLGTASPARDAAR*
Coding >Ophcf2|05710
ATGGCCAGCGCCACGGGCATGCCCGCGCGGGCCGAGGCTGGTGGCCCCGAGCCATCGGACACGGAGCCTCTCCTC
GGACGGCCCGGCGACGTGATCCAGCGGCGCGACACGTCATTTCCCCGAAACTTGATTATGGGAACGGCCTCGCTC
GCTCAACTCGGCGCCGTCCTCGGCCTGATCCTCGTCTGGGCTTCGGTCTTCAATAAGCCGCTGATTCTTTTCTCC
GCCCATCCGTTGCTGCAGTCTCTTGCCGTCTTCACCCTCATCCAGTCGGTGCTGTCGCTGCAACCGACTCACACG
GCCGAGCAGAAGCGGCTGGGTCAGCGCGTCCACGCGTCTCTCAACCTCGTGGCTCTCTTGCTGCTCATTGCCGGC
GTCACCATCATCGAGTACAACAAGCTGTCGTCTCATGGCCCGCACTTTCACTCGGTCCACGGCTACCTCGGCGTC
ATTGTCAGCATCATCATCATCATGCAGTACCTCGTCGGCTTCACCATGTGGGCAGTCCCGGCTCTGTACGGCGGC
GAGGTCCGTGCCCGCTCCGTCTGGAAATACCACCGCTACTCGGGATATGTGGTGCTCCTGCTGCTGCTCGTGACG
GTGTGCAGCGCCACCGAGACAGATTACAACCGCAATGTGCTGCACATGAAGCTCTGGGCCACTGTTCTGGCCTCC
ATCCTCGTCGTTGTCGGCGTCTTCCCACGCATCCAGAAGTACAAGCTCGGACTCGGCACTGCGTCTCCTGCACGC
GATGCTGCCCGTTAA
Transcript >Ophcf2|05710
ATGGCCAGCGCCACGGGCATGCCCGCGCGGGCCGAGGCTGGTGGCCCCGAGCCATCGGACACGGAGCCTCTCCTC
GGACGGCCCGGCGACGTGATCCAGCGGCGCGACACGTCATTTCCCCGAAACTTGATTATGGGAACGGCCTCGCTC
GCTCAACTCGGCGCCGTCCTCGGCCTGATCCTCGTCTGGGCTTCGGTCTTCAATAAGCCGCTGATTCTTTTCTCC
GCCCATCCGTTGCTGCAGTCTCTTGCCGTCTTCACCCTCATCCAGTCGGTGCTGTCGCTGCAACCGACTCACACG
GCCGAGCAGAAGCGGCTGGGTCAGCGCGTCCACGCGTCTCTCAACCTCGTGGCTCTCTTGCTGCTCATTGCCGGC
GTCACCATCATCGAGTACAACAAGCTGTCGTCTCATGGCCCGCACTTTCACTCGGTCCACGGCTACCTCGGCGTC
ATTGTCAGCATCATCATCATCATGCAGTACCTCGTCGGCTTCACCATGTGGGCAGTCCCGGCTCTGTACGGCGGC
GAGGTCCGTGCCCGCTCCGTCTGGAAATACCACCGCTACTCGGGATATGTGGTGCTCCTGCTGCTGCTCGTGACG
GTGTGCAGCGCCACCGAGACAGATTACAACCGCAATGTGCTGCACATGAAGCTCTGGGCCACTGTTCTGGCCTCC
ATCCTCGTCGTTGTCGGCGTCTTCCCACGCATCCAGAAGTACAAGCTCGGACTCGGCACTGCGTCTCCTGCACGC
GATGCTGCCCGTTAA
Gene >Ophcf2|05710
ATGGCCAGCGCCACGGGCATGCCCGCGCGGGCCGAGGCTGGTGGCCCCGAGCCATCGGACACGGAGCCTCTCCTC
GGACGGCCCGGCGACGTGATCCAGCGGCGCGACACGTCATTTCCCCGAAACTTGATTATGGGTATGCTGCTGCCA
GCGCTGCCTCGGCTCCTTCGTCTCGGATGATGCGCTGACCGGATGGCTCGTCAGGAACGGCCTCGCTCGCTCAAC
TCGGCGCCGTCCTCGGCCTGATCCTCGTCTGGGCTTCGGTCTTCAATAAGCCGCTGATTCTTTTCTCCGCCCATC
CGTTGCTGCAGTCTCTTGCCGTCTTCACCCTCATCCAGTCGGTGCTGTCGCTGCAACCGACTCACACGGCCGAGC
AGAAGCGGCTGGGTCAGCGCGTCCACGCGTCTCTCAACCTCGTGGCTCTCTTGCTGCTCATTGCCGGCGTCACCA
TCATCGAGTACAACAAGCTGTCGTCTCATGGCCCGCACTTTCACTCGGTCCACGGCTACCTCGGCGTCATTGTCA
GCATCATCATCATCATGCAGTACCTCGTCGGCTTCACCATGTGGGCAGTCCCGGCTCTGTACGGCGGCGAGGTCC
GTGCCCGCTCCGTCTGGAAATACCACCGCTACTCGGGATATGTGGTGCTCCTGCTGCTGCTCGTGACGGTGTGCA
GCGCCACCGAGACAGATTACAACCGCAATGTGCTGCACATGAAGCTCTGGGCCACTGTTCTGGCCTCCATCCTCG
TCGTTGTCGGCGTCTTCCCACGCATCCAGAAGTACAAGCTCGGACTCGGCACTGCGTCTCCTGCACGCGATGCTG
CCCGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail