Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05707
Gene name
Locationscaffold_06:2059019..2059685
Strand-
Gene length (bp)666
Transcript length (bp)666
Coding sequence length (bp)666
Protein length (aa) 222

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06658 DUF1168 Protein of unknown function (DUF1168) 2.1E-34 43 163

GO

GO Term Description Terminal node
GO:0003725 double-stranded RNA binding Yes
GO:0003723 RNA binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.15 0.9409 0.0471 0.0118 0.331 0.0053 0.0168 0.005 0.0055 0.0152

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1269
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7511
Ophiocordyceps australis map64 (Brazil) OphauB2|2368
Ophiocordyceps camponoti-floridani Ophcf2|05707 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|288
Ophiocordyceps kimflemingae Ophio5|6464
Ophiocordyceps subramaniannii Hirsu2|1053

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05707
MSGEGPEAIPTSADARSRRPTKKRALSPTSTHAASVKALFAKPDREIRLPASSSSSSSSTTITASSARRPPPEII
TNVQGSSAGAGSGEFHVYKASRRREYERLRDMDAELQRQRDQEGFVRDQEERDRRDRDKTRRNRDKRDKAKARKA
AAAASKKSDSSALASAFTSASDPSPAPAFDHDINRLSVATLTPRNRPDDRDRHDGPATASPATGLVIHDDD*
Coding >Ophcf2|05707
ATGTCAGGCGAAGGCCCCGAAGCAATCCCCACCTCCGCAGACGCCCGCTCCCGCCGCCCGACCAAAAAACGCGCA
CTATCCCCAACCTCCACCCACGCCGCCTCCGTAAAAGCCCTCTTCGCCAAACCCGACCGCGAGATTCGCCTCCCC
GCCTCCTCCTCCTCCTCCTCCTCCTCCACCACGATCACCGCCTCCTCCGCCCGTCGCCCGCCGCCCGAGATCATT
ACCAACGTTCAGGGCTCCAGCGCGGGCGCCGGCTCCGGCGAGTTTCACGTCTACAAGGCTTCCAGGAGGAGGGAG
TACGAGCGGCTTCGGGATATGGATGCCGAGTTGCAGCGGCAGCGTGATCAGGAGGGTTTCGTGCGTGATCAGGAG
GAGAGGGATAGAAGGGATCGTGATAAGACGAGGAGGAATCGCGATAAGAGGGACAAGGCAAAGGCTAGGAAGGCT
GCCGCCGCCGCCAGCAAAAAGTCGGATTCGTCCGCCCTTGCCTCCGCCTTCACCTCGGCCTCGGACCCGTCTCCG
GCACCGGCATTCGACCACGACATCAACCGCTTATCCGTCGCCACACTGACCCCCCGCAACCGCCCCGACGACCGA
GACCGACACGACGGACCGGCTACTGCCTCGCCGGCTACGGGCCTCGTTATTCACGACGACGACTGA
Transcript >Ophcf2|05707
ATGTCAGGCGAAGGCCCCGAAGCAATCCCCACCTCCGCAGACGCCCGCTCCCGCCGCCCGACCAAAAAACGCGCA
CTATCCCCAACCTCCACCCACGCCGCCTCCGTAAAAGCCCTCTTCGCCAAACCCGACCGCGAGATTCGCCTCCCC
GCCTCCTCCTCCTCCTCCTCCTCCTCCACCACGATCACCGCCTCCTCCGCCCGTCGCCCGCCGCCCGAGATCATT
ACCAACGTTCAGGGCTCCAGCGCGGGCGCCGGCTCCGGCGAGTTTCACGTCTACAAGGCTTCCAGGAGGAGGGAG
TACGAGCGGCTTCGGGATATGGATGCCGAGTTGCAGCGGCAGCGTGATCAGGAGGGTTTCGTGCGTGATCAGGAG
GAGAGGGATAGAAGGGATCGTGATAAGACGAGGAGGAATCGCGATAAGAGGGACAAGGCAAAGGCTAGGAAGGCT
GCCGCCGCCGCCAGCAAAAAGTCGGATTCGTCCGCCCTTGCCTCCGCCTTCACCTCGGCCTCGGACCCGTCTCCG
GCACCGGCATTCGACCACGACATCAACCGCTTATCCGTCGCCACACTGACCCCCCGCAACCGCCCCGACGACCGA
GACCGACACGACGGACCGGCTACTGCCTCGCCGGCTACGGGCCTCGTTATTCACGACGACGACTGA
Gene >Ophcf2|05707
ATGTCAGGCGAAGGCCCCGAAGCAATCCCCACCTCCGCAGACGCCCGCTCCCGCCGCCCGACCAAAAAACGCGCA
CTATCCCCAACCTCCACCCACGCCGCCTCCGTAAAAGCCCTCTTCGCCAAACCCGACCGCGAGATTCGCCTCCCC
GCCTCCTCCTCCTCCTCCTCCTCCTCCACCACGATCACCGCCTCCTCCGCCCGTCGCCCGCCGCCCGAGATCATT
ACCAACGTTCAGGGCTCCAGCGCGGGCGCCGGCTCCGGCGAGTTTCACGTCTACAAGGCTTCCAGGAGGAGGGAG
TACGAGCGGCTTCGGGATATGGATGCCGAGTTGCAGCGGCAGCGTGATCAGGAGGGTTTCGTGCGTGATCAGGAG
GAGAGGGATAGAAGGGATCGTGATAAGACGAGGAGGAATCGCGATAAGAGGGACAAGGCAAAGGCTAGGAAGGCT
GCCGCCGCCGCCAGCAAAAAGTCGGATTCGTCCGCCCTTGCCTCCGCCTTCACCTCGGCCTCGGACCCGTCTCCG
GCACCGGCATTCGACCACGACATCAACCGCTTATCCGTCGCCACACTGACCCCCCGCAACCGCCCCGACGACCGA
GACCGACACGACGGACCGGCTACTGCCTCGCCGGCTACGGGCCTCGTTATTCACGACGACGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail