Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05694
Gene name
Locationscaffold_06:2017935..2018676
Strand+
Gene length (bp)741
Transcript length (bp)561
Coding sequence length (bp)561
Protein length (aa) 187

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 8.6E-14 16 84

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.0659 0.0752 0.8421 0.4779 0.0835 0.0023 0.1137 0.0992 0.095 0.0047

SignalP

SignalP signal predicted Location Score
Yes 1 - 16 0.999746

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1045
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3793
Ophiocordyceps australis map64 (Brazil) OphauB2|1010
Ophiocordyceps camponoti-floridani Ophcf2|05694 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2070
Ophiocordyceps kimflemingae Ophio5|3256
Ophiocordyceps kimflemingae Ophio5|5795
Ophiocordyceps subramaniannii Hirsu2|9741

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05694
MKSAIFAVSLAAAAVAQNLPQCPTDCLNSMNTQKAQSLGCENNDFKCLCTKQNWVFGIRDCVAEACNNGQLVVDA
LNDAKNTCAQNGVQIDVNGINTSAGGPTATDVVVATTVATPATTVATVFSTFSSGGSLASTPLVTTTIGAQTTTT
VTAGSTTSTSRGFAAQVTAAPAAGMLAAAGLAALMI*
Coding >Ophcf2|05694
ATGAAGTCCGCCATCTTCGCCGTCTCTCTGGCTGCTGCCGCTGTTGCCCAGAACCTTCCTCAGTGCCCGACGGAC
TGCCTGAACAGCATGAACACGCAGAAGGCCCAGTCGCTCGGCTGCGAGAACAACGACTTCAAGTGCCTCTGCACC
AAGCAGAACTGGGTCTTTGGTATCCGTGACTGCGTTGCCGAGGCCTGCAACAACGGCCAGCTCGTCGTTGACGCC
CTCAACGACGCCAAGAACACCTGCGCCCAGAACGGTGTTCAGATCGACGTCAACGGCATTAACACGTCGGCCGGC
GGTCCCACCGCCACTGATGTCGTTGTTGCCACCACTGTCGCTACCCCCGCCACGACTGTCGCGACCGTTTTCAGC
ACGTTCTCTTCGGGCGGCTCGCTCGCGTCGACGCCCCTCGTCACCACGACGATTGGCGCTCAGACTACCACGACG
GTCACTGCCGGCTCCACGACGTCCACCAGCCGTGGCTTCGCCGCTCAGGTAACGGCCGCTCCCGCCGCTGGCATG
CTCGCCGCCGCCGGTCTCGCCGCCCTCATGATCTAG
Transcript >Ophcf2|05694
ATGAAGTCCGCCATCTTCGCCGTCTCTCTGGCTGCTGCCGCTGTTGCCCAGAACCTTCCTCAGTGCCCGACGGAC
TGCCTGAACAGCATGAACACGCAGAAGGCCCAGTCGCTCGGCTGCGAGAACAACGACTTCAAGTGCCTCTGCACC
AAGCAGAACTGGGTCTTTGGTATCCGTGACTGCGTTGCCGAGGCCTGCAACAACGGCCAGCTCGTCGTTGACGCC
CTCAACGACGCCAAGAACACCTGCGCCCAGAACGGTGTTCAGATCGACGTCAACGGCATTAACACGTCGGCCGGC
GGTCCCACCGCCACTGATGTCGTTGTTGCCACCACTGTCGCTACCCCCGCCACGACTGTCGCGACCGTTTTCAGC
ACGTTCTCTTCGGGCGGCTCGCTCGCGTCGACGCCCCTCGTCACCACGACGATTGGCGCTCAGACTACCACGACG
GTCACTGCCGGCTCCACGACGTCCACCAGCCGTGGCTTCGCCGCTCAGGTAACGGCCGCTCCCGCCGCTGGCATG
CTCGCCGCCGCCGGTCTCGCCGCCCTCATGATCTAG
Gene >Ophcf2|05694
ATGAAGTCCGCCATCTTCGCCGTCTCTCTGGCTGCTGCCGCTGTTGCCCAGAACCTTCCTCAGTGCCCGGTACGT
TGTCTTCACTCGTGTGCATCTCCACCAACCGCACTGCTGACGGCAACCTTCAGACGGACTGCCTGAACAGCATGA
ACACGCAGAAGGCCCAGTCGCTCGGCTGCGAGAACAACGACTTCAAGTGCCTCTGCACCAAGCAGAACTGGGTCT
TTGGTATCCGTGACTGCGTTGCCGAGGCCTGCAACAACGGCCAGCTCGTCGTTGACGCCCTCAACGACGCCAAGA
ACACCTGCGCCCAGAACGGTGTTCAGATCGACGTCAACGGCATTAACACGTCGGCCGGCGGTCCCACCGTATGTC
TTTGCCCTCGTCTCAAGCAACGGCTCGCTTGCTAACTACCTATGCGTTATAGGCCACTGATGTCGTTGTTGCCAC
CACTGTCGCTACCCCCGCCACGACTGTCGCGACCGTTTTCAGCACGTTCTCTTCGGGCGGCTCGCTCGCGTCGAC
GCCCCTCGTCACCACGACGATTGGCGCTCAGACTACCACGACGGTCACTGCCGGCTCCACGACGTCCACCAGCCG
TGGCTTCGCCGTGAGTGGCCCCAAAAGTTCCGACGTGAAGGGACACAATGCTGACGAGGTGTCTCTCTGCAGGCT
CAGGTAACGGCCGCTCCCGCCGCTGGCATGCTCGCCGCCGCCGGTCTCGCCGCCCTCATGATCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail