Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05684
Gene name
Locationscaffold_06:1992320..1993504
Strand+
Gene length (bp)1184
Transcript length (bp)1125
Coding sequence length (bp)1125
Protein length (aa) 375

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 1.2E-17 10 82
PF04116 FA_hydroxylase Fatty acid hydroxylase 8.4E-12 224 366

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0008610 lipid biosynthetic process Yes
GO:0005506 iron ion binding Yes
GO:0006629 lipid metabolic process No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0046914 transition metal ion binding No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 191 213 22
2 220 242 22
3 275 297 22
4 304 326 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05684
MPSRTLPTLTRAEVQSHDSASSCYVTIGSKVFDVTDFLADHPGGPDLILEYAGKDVEDILQDYASHPHSEAAYEV
LDDSLIGFVASPKAVVPATNGAAALPVKTDSGGIPYVHPRTGMSCEDDLSKETDYSQDYNKHKFLDLGKPLFPQV
WYGGFSKEFYLDQVHRPRHYKGGRSAPLFGNFLEPLTKTPWWLIPTIWLPCVAYGTYLASQGYYGPAATASFWAF
GLFLWTLVEYGMHRFLFHVDDYLPDNRVGITAHFLLHGVHHYLPMDKYRLVMPPVLFVVLATPFWRLAHFLLSFD
WHAATAVFCGGIFGYICYDLTHYFLHHQNLPLWYKQLKKYHLQHHFLDYELGFGVTSKFWDTVFGTELQPIKMK*
Coding >Ophcf2|05684
ATGCCTTCGAGGACGCTCCCGACGCTGACTCGCGCCGAGGTGCAGTCGCACGACTCTGCCTCGTCGTGCTACGTC
ACCATTGGCTCCAAGGTCTTCGATGTCACCGATTTCCTCGCCGATCACCCCGGCGGCCCCGACCTCATCCTCGAA
TATGCCGGCAAGGACGTCGAGGATATCCTCCAGGACTACGCGTCGCACCCACACTCTGAGGCTGCCTACGAGGTT
CTCGACGACTCCTTGATCGGCTTCGTTGCCTCACCAAAGGCTGTTGTTCCCGCCACAAACGGCGCGGCGGCGTTG
CCCGTCAAGACCGACTCCGGCGGCATCCCCTACGTCCACCCGCGCACCGGCATGTCGTGTGAGGACGATTTATCG
AAAGAGACCGACTACAGCCAGGACTATAACAAGCACAAGTTTCTCGACCTCGGAAAGCCGCTCTTCCCTCAAGTC
TGGTACGGCGGGTTCAGCAAAGAATTCTATCTAGATCAGGTTCACCGCCCGCGCCATTACAAAGGTGGCAGGTCG
GCGCCCCTATTCGGCAACTTCCTCGAGCCGCTCACCAAGACCCCGTGGTGGTTGATCCCGACTATCTGGCTGCCG
TGTGTCGCATACGGCACCTATCTGGCTTCACAAGGCTACTACGGACCCGCGGCCACGGCCTCTTTCTGGGCGTTT
GGTCTCTTTCTTTGGACGCTTGTCGAGTACGGCATGCATCGGTTTCTGTTTCACGTGGATGACTATCTGCCTGAT
AACCGGGTTGGCATCACGGCGCATTTTCTGCTGCATGGCGTCCATCACTATCTCCCGATGGACAAGTATCGCCTG
GTGATGCCGCCCGTTCTCTTTGTCGTTCTGGCGACTCCGTTCTGGCGTCTGGCTCATTTTCTTCTGTCCTTCGAC
TGGCACGCAGCTACGGCCGTCTTCTGCGGCGGCATCTTCGGCTACATCTGTTACGACCTGACGCATTACTTCCTG
CACCACCAGAACCTTCCTCTGTGGTACAAGCAGCTCAAGAAGTACCACTTGCAGCATCACTTTTTGGATTACGAG
CTGGGGTTTGGGGTCACGAGCAAGTTCTGGGACACCGTCTTCGGCACAGAGCTGCAGCCCATCAAGATGAAGTAG
Transcript >Ophcf2|05684
ATGCCTTCGAGGACGCTCCCGACGCTGACTCGCGCCGAGGTGCAGTCGCACGACTCTGCCTCGTCGTGCTACGTC
ACCATTGGCTCCAAGGTCTTCGATGTCACCGATTTCCTCGCCGATCACCCCGGCGGCCCCGACCTCATCCTCGAA
TATGCCGGCAAGGACGTCGAGGATATCCTCCAGGACTACGCGTCGCACCCACACTCTGAGGCTGCCTACGAGGTT
CTCGACGACTCCTTGATCGGCTTCGTTGCCTCACCAAAGGCTGTTGTTCCCGCCACAAACGGCGCGGCGGCGTTG
CCCGTCAAGACCGACTCCGGCGGCATCCCCTACGTCCACCCGCGCACCGGCATGTCGTGTGAGGACGATTTATCG
AAAGAGACCGACTACAGCCAGGACTATAACAAGCACAAGTTTCTCGACCTCGGAAAGCCGCTCTTCCCTCAAGTC
TGGTACGGCGGGTTCAGCAAAGAATTCTATCTAGATCAGGTTCACCGCCCGCGCCATTACAAAGGTGGCAGGTCG
GCGCCCCTATTCGGCAACTTCCTCGAGCCGCTCACCAAGACCCCGTGGTGGTTGATCCCGACTATCTGGCTGCCG
TGTGTCGCATACGGCACCTATCTGGCTTCACAAGGCTACTACGGACCCGCGGCCACGGCCTCTTTCTGGGCGTTT
GGTCTCTTTCTTTGGACGCTTGTCGAGTACGGCATGCATCGGTTTCTGTTTCACGTGGATGACTATCTGCCTGAT
AACCGGGTTGGCATCACGGCGCATTTTCTGCTGCATGGCGTCCATCACTATCTCCCGATGGACAAGTATCGCCTG
GTGATGCCGCCCGTTCTCTTTGTCGTTCTGGCGACTCCGTTCTGGCGTCTGGCTCATTTTCTTCTGTCCTTCGAC
TGGCACGCAGCTACGGCCGTCTTCTGCGGCGGCATCTTCGGCTACATCTGTTACGACCTGACGCATTACTTCCTG
CACCACCAGAACCTTCCTCTGTGGTACAAGCAGCTCAAGAAGTACCACTTGCAGCATCACTTTTTGGATTACGAG
CTGGGGTTTGGGGTCACGAGCAAGTTCTGGGACACCGTCTTCGGCACAGAGCTGCAGCCCATCAAGATGAAGTAG
Gene >Ophcf2|05684
ATGCCTTCGAGGACGCTCCCGACGCTGACTCGCGCCGAGGTGCAGTCGCACGACTCTGCCTCGTCGTGCTACGTC
ACCATTGGCTCCAAGGTCTTCGATGTCACCGATTTCCTCGCCGATCACCCCGGCGGCCCCGACCTCATCCTCGAA
TATGCCGGCAAGGACGTCGAGGATATCCTCCAGGACTACGCGTCGCACCCACACTCTGAGGCTGCCTACGAGGTT
CTCGACGACTCCTTGATCGGCTTCGTTGCCTCACCAAAGGCTGTTGTTCCCGCCACAAACGGCGCGGCGGCGTTG
CCCGTCAAGACCGACTCCGGCGGCATCCCCTACGTCCACCCGCGCACCGGCATGTCGTGTGAGGACGATTTATCG
AAAGAGACCGACTACAGCCAGGACTATAACAAGCACAAGTTTCTCGACCTCGGAAAGCCGCTCTTCCCTCAAGTC
TGGTACGGCGGGTTCAGCAAAGAATTCTATCTAGATCAGGTTCACCGCCCGCGCCATTACAAAGGTGGCAGGTCG
GCGCCCCTATTCGGCAACTTCCTCGAGCCGCTCACCAAGACCCCGTGGTGGTTGATCCCGACTATCTGGCTGCCG
TGTGTCGCATACGGCACCTATCTGGCTTCACAAGGCTACTACGGACCCGCGGCCACGGCCTCTTTCTGGGCGTTT
GGTCTCTTTCTTTGGACGCTTGTCGAGTACGGCATGCATCGGTTTCTGTTTCACGTGGATGAGTACGTCTAGGCC
TGGCCATCTTTTCGCGGGGCGTTTCTTTGGCTGATGTCGAATACAGCTATCTGCCTGATAACCGGGTTGGCATCA
CGGCGCATTTTCTGCTGCATGGCGTCCATCACTATCTCCCGATGGACAAGTATCGCCTGGTGATGCCGCCCGTTC
TCTTTGTCGTTCTGGCGACTCCGTTCTGGCGTCTGGCTCATTTTCTTCTGTCCTTCGACTGGCACGCAGCTACGG
CCGTCTTCTGCGGCGGCATCTTCGGCTACATCTGTTACGACCTGACGCATTACTTCCTGCACCACCAGAACCTTC
CTCTGTGGTACAAGCAGCTCAAGAAGTACCACTTGCAGCATCACTTTTTGGATTACGAGCTGGGGTTTGGGGTCA
CGAGCAAGTTCTGGGACACCGTCTTCGGCACAGAGCTGCAGCCCATCAAGATGAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail