Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05678
Gene name
Locationscaffold_06:1977368..1978612
Strand+
Gene length (bp)1244
Transcript length (bp)1071
Coding sequence length (bp)1071
Protein length (aa) 357

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03239 FTR1 Iron permease FTR1 family 2.7E-79 9 312

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0033573 high-affinity iron permease complex Yes
GO:0005381 iron ion transmembrane transporter activity Yes
GO:0034755 iron ion transmembrane transport Yes
GO:1902494 catalytic complex No
GO:0032991 protein-containing complex No
GO:0034220 ion transmembrane transport No
GO:1990351 transporter complex No
GO:0000041 transition metal ion transport No
GO:0098655 cation transmembrane transport No
GO:0005215 transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:1902495 transmembrane transporter complex No
GO:0046915 transition metal ion transmembrane transporter activity No
GO:0006810 transport No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0046873 metal ion transmembrane transporter activity No
GO:0006811 ion transport No
GO:0055085 transmembrane transport No
GO:0098796 membrane protein complex No
GO:0030001 metal ion transport No
GO:0015075 ion transmembrane transporter activity No
GO:0006826 iron ion transport No
GO:0098660 inorganic ion transmembrane transport No
GO:0008150 biological_process No
GO:0098797 plasma membrane protein complex No
GO:1905862 ferroxidase complex No
GO:0005575 cellular_component No
GO:0098662 inorganic cation transmembrane transport No
GO:1990204 oxidoreductase complex No
GO:0008324 cation transmembrane transporter activity No
GO:0006812 cation transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 51 73 22
3 88 110 22
4 144 166 22
5 176 195 19
6 207 229 22
7 288 310 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 43.73 22.44 65.01
Alive In ants, during behavior modification 114.00 63.47 164.53
Dead In ants, recently dead 98.39 55.86 140.92

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.412415 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05678
MGSPYFFSVPVFLIVFRETLEAVIIVSILLAFLSQTLDKNAQAYRVLRRQVWIGVASGFVLCMIIAGAVIGVWYT
LSKNSWEANENYYEGAFCIVASVIITIMGAALLRIGNMRDKWRVKVARALDAPVKTGSRRWWAQLPEKYAMFYLP
FITVLREGVEAVVFIAGVSFPEPATAVPLPVIVGLGLGIFIGWLLYKGASTAKLQLFLVLSTCLLYLVAAGLFSR
GVWHFETQEWNIAVGGDAAETGDGPGSYDIDRSVWHVNCCSPVGPNSRGWGIFNAILGWQNSATYGSVISYNMYW
IAVVTAFVVMRFRENKSNWPAFGTDSPKDDSQASDNGAGVVESKHIPQEKTVAVSA*
Coding >Ophcf2|05678
ATGGGTTCCCCATACTTCTTCTCCGTCCCCGTCTTCCTCATCGTCTTCCGCGAGACGCTCGAGGCCGTCATCATC
GTCTCCATCCTCCTCGCCTTTCTCAGCCAGACGCTCGACAAGAATGCGCAGGCCTACCGTGTCTTGAGGCGCCAG
GTCTGGATCGGCGTCGCCTCCGGCTTCGTTCTCTGCATGATTATCGCCGGCGCCGTCATTGGCGTCTGGTACACC
CTCAGTAAAAACTCGTGGGAGGCAAACGAAAACTACTACGAGGGCGCCTTCTGCATCGTCGCCTCCGTCATCATC
ACCATCATGGGCGCCGCTCTCCTGCGCATTGGCAATATGCGCGACAAATGGCGTGTCAAGGTCGCTCGCGCCTTG
GATGCTCCCGTCAAGACCGGCTCGCGTCGCTGGTGGGCGCAGCTGCCAGAGAAATATGCCATGTTCTACCTGCCC
TTCATCACCGTTCTTCGTGAGGGAGTCGAGGCCGTCGTCTTCATCGCCGGCGTCTCCTTTCCCGAGCCGGCCACT
GCCGTGCCGCTGCCCGTCATCGTCGGCCTTGGCCTCGGCATCTTCATCGGCTGGCTCCTGTACAAGGGCGCCTCT
ACCGCCAAGTTGCAGCTGTTCCTCGTCCTTTCCACCTGCCTGCTGTATCTCGTCGCCGCCGGCCTCTTCTCCCGT
GGCGTCTGGCACTTTGAGACGCAGGAGTGGAACATTGCCGTGGGAGGCGATGCCGCAGAGACCGGTGACGGACCA
GGCTCCTATGACATCGACAGGAGTGTGTGGCACGTCAATTGCTGCTCGCCCGTGGGTCCCAATTCTCGCGGCTGG
GGTATTTTCAATGCTATTCTGGGCTGGCAGAATTCGGCCACGTACGGGTCCGTCATTTCGTACAACATGTACTGG
ATCGCCGTCGTCACCGCCTTTGTCGTCATGCGCTTCCGCGAGAACAAGAGCAACTGGCCTGCGTTCGGTACCGAC
TCACCCAAGGACGACTCTCAAGCAAGTGACAACGGGGCCGGCGTTGTCGAGTCCAAGCATATTCCACAGGAGAAG
ACGGTGGCCGTGTCGGCTTAG
Transcript >Ophcf2|05678
ATGGGTTCCCCATACTTCTTCTCCGTCCCCGTCTTCCTCATCGTCTTCCGCGAGACGCTCGAGGCCGTCATCATC
GTCTCCATCCTCCTCGCCTTTCTCAGCCAGACGCTCGACAAGAATGCGCAGGCCTACCGTGTCTTGAGGCGCCAG
GTCTGGATCGGCGTCGCCTCCGGCTTCGTTCTCTGCATGATTATCGCCGGCGCCGTCATTGGCGTCTGGTACACC
CTCAGTAAAAACTCGTGGGAGGCAAACGAAAACTACTACGAGGGCGCCTTCTGCATCGTCGCCTCCGTCATCATC
ACCATCATGGGCGCCGCTCTCCTGCGCATTGGCAATATGCGCGACAAATGGCGTGTCAAGGTCGCTCGCGCCTTG
GATGCTCCCGTCAAGACCGGCTCGCGTCGCTGGTGGGCGCAGCTGCCAGAGAAATATGCCATGTTCTACCTGCCC
TTCATCACCGTTCTTCGTGAGGGAGTCGAGGCCGTCGTCTTCATCGCCGGCGTCTCCTTTCCCGAGCCGGCCACT
GCCGTGCCGCTGCCCGTCATCGTCGGCCTTGGCCTCGGCATCTTCATCGGCTGGCTCCTGTACAAGGGCGCCTCT
ACCGCCAAGTTGCAGCTGTTCCTCGTCCTTTCCACCTGCCTGCTGTATCTCGTCGCCGCCGGCCTCTTCTCCCGT
GGCGTCTGGCACTTTGAGACGCAGGAGTGGAACATTGCCGTGGGAGGCGATGCCGCAGAGACCGGTGACGGACCA
GGCTCCTATGACATCGACAGGAGTGTGTGGCACGTCAATTGCTGCTCGCCCGTGGGTCCCAATTCTCGCGGCTGG
GGTATTTTCAATGCTATTCTGGGCTGGCAGAATTCGGCCACGTACGGGTCCGTCATTTCGTACAACATGTACTGG
ATCGCCGTCGTCACCGCCTTTGTCGTCATGCGCTTCCGCGAGAACAAGAGCAACTGGCCTGCGTTCGGTACCGAC
TCACCCAAGGACGACTCTCAAGCAAGTGACAACGGGGCCGGCGTTGTCGAGTCCAAGCATATTCCACAGGAGAAG
ACGGTGGCCGTGTCGGCTTAG
Gene >Ophcf2|05678
ATGGGTTCCCCATACTTCTTCTCCGTCCCCGTCTTCCTCATCGTCTTCCGCGAGACGCTCGAGGCCGTCATCATC
GTCTCCATCCTCCTCGCCTTTCTCAGCCAGACGCTCGACAAGAATGCGCAGGCCTACCGTGTCTTGAGGCGCCAG
GTGACGATGCCTTCTCTTTCCCCTCGACCCGTCCATATCGTTGACCCGGTCTGAAGGTCTGGATCGGCGTCGCCT
CCGGCTTCGTTCTCTGCATGATTATCGCCGGCGCCGTCATTGGCGTCTGGTACACCCTCAGTAAAAACTCGTGGG
AGGCAAACGAAAACTACTACGAGGGCGCCTTCTGCATCGTCGCCTCCGTCATCATCACCATCATGGGCGCCGCTC
TCCTGCGCATTGGCAATATGCGCGACAAATGGCGTGTCAAGGTCGCTCGCGCCTTGGATGCTCCCGTCAAGACCG
GCTCGCGTCGCTGGTGGGCGCAGCTGCCAGAGAAATATGCCATGTTCTACCTGCCCTTCATCACCGTTCTTCGTG
AGGGAGTCGAGGCCGTCGTCTTCATCGCCGGCGTCTCCTTTCCCGAGCCGGCCACTGCCGTGCCGCTGCCCGTCA
TCGTCGGCCTTGGCCTCGGCATCTTCATCGGCTGGCTCCTGTACAAGTGCGTTCGAACATCGGCCTCCATTGGCC
CGTGCCGCCCTGCTAACCTTTATCGCCTGACTCCAGGGGCGCCTCTACCGCCAAGTTGCAGCTGTTCCTCGTCCT
TTCCACCTGCCTGCTGTATCTCGTCGCCGCCGGCCTCTTCTCCCGTGGCGTCTGGCACTTTGAGACGCAGGAGTG
GAACATTGCCGTGGGAGGCGATGCCGCAGAGACCGGTGACGGACCAGGCTCCTATGACATCGACAGGAGTGTGTG
GCACGTCAATGTAAGCTTCCCCTCAGCCTCCCAGGTTGATCCCGGTCCTGACCCCCGCCAAGTGCTGCTCGCCCG
TGGGTCCCAATTCTCGCGGCTGGGGTATTTTCAATGCTATTCTGGGCTGGCAGAATTCGGCCACGTACGGGTCCG
TCATTTCGTACAACATGTACTGGATCGCCGTCGTCACCGCCTTTGTCGTCATGCGCTTCCGCGAGAACAAGAGCA
ACTGGCCTGCGTTCGGTACCGACTCACCCAAGGACGACTCTCAAGCAAGTGACAACGGGGCCGGCGTTGTCGAGT
CCAAGCATATTCCACAGGAGAAGACGGTGGCCGTGTCGGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail