Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05677
Gene name
Locationscaffold_06:1974746..1977239
Strand-
Gene length (bp)2493
Transcript length (bp)1998
Coding sequence length (bp)1998
Protein length (aa) 666

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07732 Cu-oxidase_3 Multicopper oxidase 4.5E-41 104 219
PF07731 Cu-oxidase_2 Multicopper oxidase 4.9E-39 438 571
PF00394 Cu-oxidase Multicopper oxidase 1.2E-32 230 376

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0005507 copper ion binding Yes
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:0003824 catalytic activity No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 627 649 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05677
MALEGASGQRDLISRWAGLDHATARNDIVKTLLGRGREGPDRLSLGQPGIDVTIVAEGRTDTLPINTTGQLYNHM
LFLPLARLALAASSASLALAATVRHDFDITWVRRNPDGAHERPVIGINHQWPIPPIHANVGDRVVIRVRNLLGNQ
TTSLHFHGLFMRGTPHMDGPDAVSQCPIPPGSEFTYDFIVNQPGTYWYHSHTHAQYPDGLRGPLIVHDADFPYRK
EIDEELVLTLSDWYHEEMSTLIPRFLSKNNPTGAEPVPQSALLNETQNLEVNVRPSRKYLLRIINMGAFAGQYFW
IEGHNLTIVEVDGVYTKRAEASMIYLSAAQRVSVIVETRSDASANFPIVGSMDTLLFDVLPDDLNYNSTGWLVYD
DAKPKPEPAPVDELEAFDDMKLVPWDGMELLPEPQRVVQLDVRMDNLGDGANYAFFGNTTYAMPKVPSLYTALSA
GELASNPAVYGEYTRPFVLAKGEVVQIVLNNQDPGRHPFHLHGHNFQAIYRSPEEAGLWEDVEEAYRKFAKVPMR
RDTLVVLPEGHIVLRFRADNPGVWLFHCHIEWHVVSGLVATFVEAPLELKGLTIPDDHLDACRQAGIPTVGNAAA
NSVDLLDLSGQNEPPAPLPDGFTPRGIAALVFSCIAGIVGVGVVAWYGFAAAQPIASPATPPASS*
Coding >Ophcf2|05677
ATGGCCTTGGAAGGGGCATCCGGGCAACGGGATCTGATAAGCCGATGGGCGGGTCTCGATCATGCCACAGCGAGG
AATGACATCGTGAAAACTCTTCTCGGGCGGGGTCGAGAGGGGCCCGACCGTCTGTCATTGGGGCAACCCGGCATC
GATGTTACCATCGTTGCTGAAGGTAGGACAGACACGCTTCCAATCAACACCACAGGCCAGCTCTACAACCACATG
CTCTTCCTCCCCCTCGCCAGGCTGGCGCTGGCCGCCTCGTCCGCCAGCCTCGCCCTCGCCGCAACCGTTCGTCAC
GACTTTGACATTACCTGGGTGCGTCGCAACCCGGACGGAGCACACGAGCGGCCTGTCATTGGCATCAATCACCAG
TGGCCCATCCCGCCCATTCATGCCAATGTCGGCGATCGCGTCGTAATCCGTGTCCGCAACCTGCTCGGCAACCAG
ACGACGTCGCTGCACTTCCATGGCCTCTTCATGCGCGGAACGCCTCATATGGACGGGCCTGATGCCGTCTCGCAG
TGTCCCATCCCGCCGGGCTCAGAGTTTACCTACGACTTCATCGTTAACCAGCCCGGTACCTACTGGTATCACTCG
CACACGCACGCTCAGTATCCCGATGGTCTTCGAGGCCCTCTCATCGTCCACGATGCCGACTTCCCCTACCGTAAG
GAAATCGACGAAGAGCTCGTCCTGACGCTTTCCGACTGGTACCACGAGGAGATGTCAACGCTCATCCCCCGTTTC
CTCAGCAAGAACAATCCCACAGGCGCCGAGCCCGTGCCCCAGTCCGCTCTCCTCAACGAGACGCAGAATCTCGAG
GTCAACGTCCGACCTAGCCGCAAGTACCTGCTCCGCATTATCAACATGGGCGCCTTCGCCGGCCAGTATTTTTGG
ATTGAGGGTCACAATTTGACCATTGTCGAGGTTGACGGCGTCTACACTAAGCGGGCTGAGGCGTCCATGATTTAC
CTCTCTGCCGCACAGCGTGTCAGCGTCATTGTCGAGACAAGGAGCGATGCCTCGGCCAACTTTCCCATCGTCGGA
AGTATGGACACGCTCCTCTTCGACGTTCTCCCCGATGACCTCAATTACAACTCAACTGGCTGGCTCGTCTACGAC
GATGCGAAGCCCAAGCCCGAGCCTGCCCCAGTGGACGAGCTCGAAGCCTTTGATGACATGAAGCTCGTCCCGTGG
GACGGCATGGAGCTGCTTCCCGAACCTCAGCGCGTCGTCCAGCTCGACGTCAGGATGGATAACCTCGGCGACGGC
GCAAACTACGCCTTCTTTGGAAATACCACCTACGCGATGCCCAAGGTACCCTCCCTCTACACGGCCCTCTCGGCT
GGCGAGCTGGCGTCGAACCCGGCCGTCTACGGCGAGTACACGCGGCCTTTCGTTCTCGCCAAGGGTGAGGTCGTC
CAGATCGTCCTCAACAACCAGGATCCGGGCCGTCACCCGTTCCATCTTCACGGTCATAATTTCCAGGCTATTTAC
CGCTCGCCCGAGGAGGCCGGCTTGTGGGAGGATGTTGAAGAGGCGTATCGCAAGTTTGCCAAGGTGCCCATGCGC
CGAGATACGCTGGTAGTGCTGCCGGAGGGTCACATCGTGCTGCGTTTCCGGGCGGACAATCCGGGTGTCTGGCTC
TTCCACTGCCATATCGAATGGCACGTCGTCTCCGGTCTCGTCGCCACCTTCGTTGAGGCCCCCTTGGAGCTGAAG
GGGCTCACCATTCCGGACGACCACCTCGACGCCTGCAGGCAAGCTGGCATCCCCACGGTCGGCAACGCCGCAGCC
AACTCTGTTGACCTGCTCGACCTTTCTGGTCAGAACGAGCCTCCCGCTCCTCTCCCGGATGGCTTCACCCCTCGT
GGAATTGCTGCCCTCGTCTTCAGCTGCATCGCCGGCATCGTCGGCGTCGGCGTCGTCGCCTGGTACGGTTTCGCT
GCTGCTCAGCCCATTGCCAGCCCTGCGACGCCGCCGGCCAGCTCATGA
Transcript >Ophcf2|05677
ATGGCCTTGGAAGGGGCATCCGGGCAACGGGATCTGATAAGCCGATGGGCGGGTCTCGATCATGCCACAGCGAGG
AATGACATCGTGAAAACTCTTCTCGGGCGGGGTCGAGAGGGGCCCGACCGTCTGTCATTGGGGCAACCCGGCATC
GATGTTACCATCGTTGCTGAAGGTAGGACAGACACGCTTCCAATCAACACCACAGGCCAGCTCTACAACCACATG
CTCTTCCTCCCCCTCGCCAGGCTGGCGCTGGCCGCCTCGTCCGCCAGCCTCGCCCTCGCCGCAACCGTTCGTCAC
GACTTTGACATTACCTGGGTGCGTCGCAACCCGGACGGAGCACACGAGCGGCCTGTCATTGGCATCAATCACCAG
TGGCCCATCCCGCCCATTCATGCCAATGTCGGCGATCGCGTCGTAATCCGTGTCCGCAACCTGCTCGGCAACCAG
ACGACGTCGCTGCACTTCCATGGCCTCTTCATGCGCGGAACGCCTCATATGGACGGGCCTGATGCCGTCTCGCAG
TGTCCCATCCCGCCGGGCTCAGAGTTTACCTACGACTTCATCGTTAACCAGCCCGGTACCTACTGGTATCACTCG
CACACGCACGCTCAGTATCCCGATGGTCTTCGAGGCCCTCTCATCGTCCACGATGCCGACTTCCCCTACCGTAAG
GAAATCGACGAAGAGCTCGTCCTGACGCTTTCCGACTGGTACCACGAGGAGATGTCAACGCTCATCCCCCGTTTC
CTCAGCAAGAACAATCCCACAGGCGCCGAGCCCGTGCCCCAGTCCGCTCTCCTCAACGAGACGCAGAATCTCGAG
GTCAACGTCCGACCTAGCCGCAAGTACCTGCTCCGCATTATCAACATGGGCGCCTTCGCCGGCCAGTATTTTTGG
ATTGAGGGTCACAATTTGACCATTGTCGAGGTTGACGGCGTCTACACTAAGCGGGCTGAGGCGTCCATGATTTAC
CTCTCTGCCGCACAGCGTGTCAGCGTCATTGTCGAGACAAGGAGCGATGCCTCGGCCAACTTTCCCATCGTCGGA
AGTATGGACACGCTCCTCTTCGACGTTCTCCCCGATGACCTCAATTACAACTCAACTGGCTGGCTCGTCTACGAC
GATGCGAAGCCCAAGCCCGAGCCTGCCCCAGTGGACGAGCTCGAAGCCTTTGATGACATGAAGCTCGTCCCGTGG
GACGGCATGGAGCTGCTTCCCGAACCTCAGCGCGTCGTCCAGCTCGACGTCAGGATGGATAACCTCGGCGACGGC
GCAAACTACGCCTTCTTTGGAAATACCACCTACGCGATGCCCAAGGTACCCTCCCTCTACACGGCCCTCTCGGCT
GGCGAGCTGGCGTCGAACCCGGCCGTCTACGGCGAGTACACGCGGCCTTTCGTTCTCGCCAAGGGTGAGGTCGTC
CAGATCGTCCTCAACAACCAGGATCCGGGCCGTCACCCGTTCCATCTTCACGGTCATAATTTCCAGGCTATTTAC
CGCTCGCCCGAGGAGGCCGGCTTGTGGGAGGATGTTGAAGAGGCGTATCGCAAGTTTGCCAAGGTGCCCATGCGC
CGAGATACGCTGGTAGTGCTGCCGGAGGGTCACATCGTGCTGCGTTTCCGGGCGGACAATCCGGGTGTCTGGCTC
TTCCACTGCCATATCGAATGGCACGTCGTCTCCGGTCTCGTCGCCACCTTCGTTGAGGCCCCCTTGGAGCTGAAG
GGGCTCACCATTCCGGACGACCACCTCGACGCCTGCAGGCAAGCTGGCATCCCCACGGTCGGCAACGCCGCAGCC
AACTCTGTTGACCTGCTCGACCTTTCTGGTCAGAACGAGCCTCCCGCTCCTCTCCCGGATGGCTTCACCCCTCGT
GGAATTGCTGCCCTCGTCTTCAGCTGCATCGCCGGCATCGTCGGCGTCGGCGTCGTCGCCTGGTACGGTTTCGCT
GCTGCTCAGCCCATTGCCAGCCCTGCGACGCCGCCGGCCAGCTCATGA
Gene >Ophcf2|05677
ATGGCCTTGGAAGGGGCATCCGGGCAACGGGATCTGATAAGCCGATGGGCGGGTCTCGATCATGCCACAGCGAGG
AATGACATCGTGAAAACTCTTCTCGGGCGGGGTCGAGAGGGGCCCGACCGTCTGTCATTGGGGCAACCCGGCATC
GATGTTACCATCGGTAAGGCAGCACGACTCGCGTGCCGAGTTATTATCAGATGGGCAGGCGTTGCTTTCGGCCAG
ATGCCGAGGCTGGCCGGATGAGTTGCTGAAGGGTGAGTTGAAGAATGTCGGCGATGCCCACGTTTGGAAGCCGGT
CTCGTCCCTTTGCCTTCTCAGTCTTTCTCTTGTTTTGTTTCTGACAGCAACACACTCACGATACTGCGGAGCAGT
AGGACAGACACGCTTCCAATCAACACCACAGGCCAGCTCTACAACCACATGCTCTTCCTCCCCCTCGCCAGGCTG
GCGCTGGCCGCCTCGTCCGCCAGCCTCGCCCTCGCCGCAACCGTTCGTCACGACTTTGACATTACCTGGGTGCGT
CGCAACCCGGACGGAGCACACGAGCGGCCTGTCATTGGCATCAATCACCAGTGGCCCATCCCGCCCATTCATGCC
AATGTCGGCGATCGCGTCGTAATCCGTGTCCGCAACCTGCTCGGCAACCAGACGACGTCGCTGCACTTCCATGGC
CTCTTCATGCGCGGAACGCCTCATATGGACGGGCCTGATGCCGTCTCGCAGTGTCCCATCCCGCCGGGCTCAGAG
TTTACCTACGACTTCATCGTCCGTTCTGACCGTTTAAAGTTTGCTCCGAGGAAATATGCTGATGCCTCGACCAGG
TTAACCAGCCCGGTACCTACTGGTATCACTCGCACACGCACGCTCAGTATCCCGATGGTCTTCGAGGCCCTCTCA
TCGTCCACGATGCCGACTTCCCCTACCGTAAGGAAATCGACGAAGAGCTCGTCCTGACGCTTTCCGACTGGTACC
ACGAGGAGATGTCAACGCTCATCCCCCGTTTCCTCAGCAAGAACAATCCCACAGGCGCCGAGCCCGTGCCCCAGT
CCGCTCTCCTCAACGAGACGCAGAATCTCGAGGTCAACGTCCGACCTAGCCGCAAGTACCTGCTCCGCATTATCA
ACATGGGCGCCTTCGCCGGCCAGTATTTTTGGATTGAGGGTCACAATTTGACCATTGTCGAGGTTGACGGCGTCT
ACACTAAGCGGGCTGAGGCGTCCATGATTTACCTCTCTGCCGCACAGCGTGTCAGCGTCATTGTCGAGACAAGGA
GCGATGCCTCGGCCAACTTTCCCATCGTCGGAAGTATGGACACGGTTCGTTTCCGATTTTCCCTCTCTCTTTTAG
ATGATCTTCACACGGCCATCAACTCATCGTGGTTACTCGAACAGCTCCTCTTCGACGTTCTCCCCGATGACCTCA
ATTACAACTCAACTGGCTGGCTCGTCTACGACGATGCGAAGCCCAAGCCCGAGCCTGCCCCAGTGGACGAGCTCG
AAGCCTTTGATGACATGAAGCTCGTCCCGTGGGACGGCATGGAGCTGCTTCCCGAACCTCAGCGCGTCGTCCAGC
TCGACGTCAGGATGGATAACCTCGGCGACGGCGCAAACTACGCCTTCTTTGGAAATACCACCTACGCGATGCCCA
AGGTACCCTCCCTCTACACGGCCCTCTCGGCTGGCGAGCTGGCGTCGAACCCGGCCGTCTACGGCGAGTACACGC
GGCCTTTCGTTCTCGCCAAGGGTGAGGTCGTCCAGATCGTCCTCAACAACCAGGATCCGGGCCGTCACCCGTTCC
ATCTTCACGGTCATAATTTCCAGGCTATTTACCGCTCGCCCGAGGAGGCCGGCTTGTGGGAGGATGTTGAAGAGG
CGTATCGCAAGTTTGCCAAGGTGCCCATGCGCCGAGATACGCTGGTAGTGCTGCCGGAGGGTCACATCGTGCTGC
GTTTCCGGGCGGACAATCCGGGTAAGTATCCCTAGACTCCTTTTTTCAAAGATGTATAAGATACTCGTGAGTCAA
AGAGGACAGCATCAGCTCATTTCTCGGCTGAACTAGGTGTCTGGCTCTTCCACTGCCATATCGAATGGCACGTCG
TCTCCGGTCTCGTCGCCACCTTCGTTGAGGCCCCCTTGGAGCTGAAGGGGCTCACCATTCCGGACGACCACCTCG
ACGCCTGCAGGCAAGCTGGCATCCCCACGGTCGGCAACGCCGCAGCCAACTCTGTTGACCTGCTCGACCTTTCTG
GTCAGAACGAGCCTCCCGCTCCTCTCCCGGATGGGTCCGTTTCTTCCTGTCCCCCGTTTCTTTCTCTTAATACTG
TGGTTTGAGTCTGACCCATCTGTTTCGCACAGCTTCACCCCTCGTGGAATTGCTGCCCTCGTCTTCAGCTGCATC
GCCGGCATCGTCGGCGTCGGCGTCGTCGCCTGGTACGGTTTCGCTGCTGCTCAGCCCATTGCCAGCCCTGCGACG
CCGCCGGCCAGCTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail