Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05674
Gene name
Locationscaffold_06:1955918..1960518
Strand+
Gene length (bp)4600
Transcript length (bp)4284
Coding sequence length (bp)4284
Protein length (aa) 1428

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00136 DNA_pol_B DNA polymerase family B 4.4E-113 786 1219
PF08996 zf-DNA_Pol DNA Polymerase alpha zinc finger 6.7E-53 1262 1415
PF03104 DNA_pol_B_exo1 DNA polymerase family B, exonuclease domain 1.5E-39 371 719
PF12254 DNA_pol_alpha_N DNA polymerase alpha subunit p180 N terminal 5.4E-23 10 75

GO

GO Term Description Terminal node
GO:0006260 DNA replication Yes
GO:0003887 DNA-directed DNA polymerase activity Yes
GO:0000166 nucleotide binding Yes
GO:0003677 DNA binding Yes
GO:0003676 nucleic acid binding No
GO:0006259 DNA metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0005488 binding No
GO:0016740 transferase activity No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008152 metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0016779 nucleotidyltransferase activity No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0044237 cellular metabolic process No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0043170 macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0140097 catalytic activity, acting on DNA No
GO:1901360 organic cyclic compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0034061 DNA polymerase activity No
GO:0090304 nucleic acid metabolic process No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2444 0.8722 0.2584 0.0204 0.115 0.0668 0.0671 0.0574 0.0345 0.005

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup638
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2313
Ophiocordyceps australis 1348a (Ghana) OphauG2|6057
Ophiocordyceps australis map64 (Brazil) OphauB2|6914
Ophiocordyceps camponoti-floridani Ophcf2|05674 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5020
Ophiocordyceps kimflemingae Ophio5|6255
Ophiocordyceps subramaniannii Hirsu2|10433
Ophiocordyceps subramaniannii Hirsu2|10434

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05674
MSKASRRAKLEELRAMRQSGKKAFDNYQVDEVKPVYDEVDDEGYNNVLRDRLERDDFVVDDNGQGYVDDGREEWD
HAQPGDSDSEAGERGRPSKAAKKKRKDEQDKRAANDRKVSDYFTHGAGSTQNKPKVAKTKEESDFMDGLLSGISS
SVADAPPVSLSRKSKSDKARSARKSRILSPVLEPAYKKQKRVDTRASSPPAPEDVDMDDGFTQLLDDDGILDAGD
AAMSDNVAPSSPTAKVAERKSQTKQEAGVKDEDEDDDLMEVSHAGALKTASVNMAASRPVKKPVDPVPDSSPKPE
AASDAIDPTSWKDLNDRLNVISSPPSESRGIGKMDHKDAIEPDGSLNFFWIDYVEVNGSLCLFGKVLDKRTEAYV
SCFVKVDNMLRKLYFLPRQQRVLDGHESGQEVTMSDVYGEVDDMMTKMKVDMYKIKACTRKYAFELPDVPREAEY
LKLLYPYTKPQMEANKQGETFSRVFGTNTALFEQFVLWKNIMGPCWLKIQDANFGALKNASHCKLEVLAEHPDMV
STTTDGDKAECPPLTLMSIALRTAFDAKQNRQEILAISARIYDKVQLSETMAVEEMACRTFTVIRPHGQSFPLGF
DQLVAKRKRGLIALKKHEGDLLSFFLAQLDVADPDVILGHQLEGVDYSVLLNRLMDRKIHQWSRLGRLRRTQWPA
SMGKMGSNVFAERQVMAGRLLCDVGNDAGKAVMAKCQSWSLTEMCSLYLTSNNRRRELDNEAALKTWAREKQGLM
DYIAHMEADTYFVAALALVVQLLPLTKVLTNLAGNSWARTLTGTRAERNEFILLHEFHRSKYICPDKPSFRGRQK
DDDEAKKKDNKYKGGLVFEPQKGLYDKFVLVMDFNSLYPSIIQEFNICFTTVDRNGATDNDDDDDADDAIPEVRP
DQPQGILPKLIATLVGRRRQVKSLMKDKKATPEQLATWDTKQLALKLTANSMYGCLGYTKSRFYARPLAVLTTYK
GREILSSTKELAESKSLQVIYGDTDSVMINANASSVADALKVGNDFKRAVNDQYKLLEIDIDHVFRRILLQAKKK
YAAVSLVDEGGRLVERMEVKGLDMRRREYCALSKDVSKHLLDDILSGEEADIVVNRIHAHLRDTASEMRRRKIPT
PKYIIFTQLGKAPADYPNADSMPQVQVALRELARGKTIRKGDVVSYITVSGDGPAPKRAHAPADLRSDADLVPDV
EWYIAKQIFPPVERLCAHIAGTSTAQLAEQLGLDIRRYQTTTTTTTTTTNPLDAELHPWRLSPTRVSPSGIICPE
CRSPLQPISIVAQVEAAIRAQTSSYYEGWLVCDDAQCGIRTRQISVYGARCLGGKGLARGECMGRMRYQYSGKAI
YNQLLYYSGLWDVDKAVAACGNDNDDDDVRALAEQNRVRFATVKAVVDGYLDKCGRQWVPMDTLFARLGFHKAMV
TG*
Coding >Ophcf2|05674
ATGTCAAAAGCCAGTCGCAGGGCCAAGCTCGAGGAGCTTCGGGCCATGCGCCAGTCGGGCAAGAAGGCGTTTGAC
AACTACCAGGTGGACGAGGTCAAACCCGTCTACGACGAGGTGGATGATGAAGGATACAACAATGTGCTGCGAGAC
CGTCTCGAACGCGACGACTTTGTAGTCGATGACAATGGCCAAGGCTACGTCGATGACGGACGAGAGGAGTGGGAT
CATGCTCAGCCCGGCGACTCGGACAGCGAGGCCGGTGAAAGAGGCAGGCCGAGCAAGGCCGCCAAGAAGAAGCGA
AAAGACGAGCAGGACAAGCGGGCTGCCAACGATCGCAAAGTCAGCGACTACTTTACCCACGGAGCGGGAAGCACC
CAGAACAAGCCCAAGGTGGCTAAAACTAAAGAAGAGAGCGATTTCATGGACGGACTGCTCTCCGGGATCTCGTCC
AGCGTCGCCGACGCACCCCCTGTCTCCCTCTCGAGAAAGTCGAAATCCGACAAAGCCAGAAGCGCTCGCAAGTCC
AGGATTCTCTCGCCCGTTCTGGAACCGGCGTACAAAAAACAGAAGCGCGTCGATACCCGAGCTTCATCCCCCCCG
GCACCTGAGGACGTGGATATGGACGATGGCTTCACTCAGCTATTGGACGACGACGGGATCCTGGACGCTGGTGAT
GCCGCTATGAGCGACAATGTAGCTCCCTCTTCCCCCACGGCCAAGGTGGCGGAGCGGAAATCTCAGACGAAACAA
GAAGCAGGCGTCAAAGACGAGGATGAAGATGACGACTTGATGGAGGTTTCTCACGCCGGCGCACTCAAGACGGCG
AGCGTCAATATGGCAGCTTCTCGGCCTGTCAAGAAGCCGGTCGATCCGGTGCCCGACAGCTCCCCGAAGCCCGAA
GCCGCATCCGACGCCATCGACCCGACATCGTGGAAGGATCTCAACGACAGGCTCAATGTTATCAGTTCTCCTCCG
TCGGAAAGCCGGGGCATCGGAAAGATGGACCACAAGGACGCCATCGAGCCCGACGGCAGCCTCAACTTCTTCTGG
ATAGACTATGTCGAGGTCAACGGAAGTCTGTGTCTCTTTGGCAAGGTGCTCGACAAGAGGACCGAAGCCTACGTG
AGCTGCTTTGTCAAGGTAGACAACATGCTGAGGAAGCTCTATTTCTTGCCTCGTCAGCAGCGCGTGCTCGATGGC
CATGAAAGCGGTCAAGAGGTCACCATGTCGGACGTCTACGGTGAAGTGGACGACATGATGACGAAGATGAAGGTC
GACATGTACAAGATCAAGGCTTGTACGCGCAAGTACGCCTTTGAGCTGCCAGACGTGCCCAGGGAGGCCGAGTAC
TTGAAGCTGCTCTATCCCTACACCAAGCCGCAGATGGAGGCGAACAAACAGGGAGAGACGTTTTCTCGCGTGTTC
GGCACCAACACGGCCCTGTTCGAGCAGTTTGTCCTGTGGAAGAACATCATGGGCCCCTGCTGGCTCAAGATCCAG
GACGCCAACTTTGGCGCCCTCAAGAACGCGTCTCACTGCAAGCTCGAGGTGCTGGCGGAGCACCCGGACATGGTA
TCGACGACGACGGACGGCGACAAGGCCGAATGCCCGCCGCTGACGCTGATGAGCATCGCGCTCAGGACGGCCTTT
GACGCGAAGCAGAACCGGCAGGAGATTCTGGCCATCAGCGCCCGCATCTACGACAAGGTACAGCTGAGCGAGACG
ATGGCGGTGGAGGAGATGGCGTGTCGGACCTTTACCGTGATAAGGCCACACGGCCAGAGTTTCCCGCTGGGTTTT
GATCAGCTGGTGGCCAAGAGGAAGAGGGGGCTGATCGCGCTGAAGAAGCACGAGGGCGACCTCCTGAGCTTCTTC
CTGGCGCAGCTGGACGTTGCCGACCCGGACGTGATACTGGGCCACCAACTTGAGGGCGTCGACTACAGCGTACTC
CTGAACCGGCTGATGGACAGGAAGATCCACCAATGGTCCAGGCTCGGCCGGCTTCGGCGGACGCAGTGGCCGGCT
TCCATGGGCAAGATGGGCAGCAACGTCTTCGCAGAGCGGCAGGTCATGGCCGGACGGCTGCTGTGCGACGTCGGC
AACGACGCGGGCAAGGCCGTCATGGCCAAGTGCCAATCATGGAGCCTGACAGAGATGTGCAGCCTGTATCTGACG
AGCAACAACCGACGACGAGAGCTGGACAACGAGGCGGCTCTCAAGACGTGGGCGCGCGAGAAGCAGGGCCTGATG
GATTACATCGCCCACATGGAGGCCGACACGTACTTCGTCGCCGCCCTGGCTCTCGTCGTCCAGCTACTGCCCCTT
ACCAAAGTGCTCACCAACCTGGCCGGCAACTCGTGGGCGCGGACACTGACGGGAACGCGAGCCGAACGCAACGAG
TTCATCCTGCTTCACGAGTTCCATCGCAGCAAGTACATCTGCCCAGACAAGCCGTCGTTCCGCGGCCGGCAGAAG
GACGACGACGAGGCCAAGAAGAAGGATAACAAGTACAAGGGCGGCCTGGTGTTTGAGCCGCAAAAGGGGCTGTAC
GACAAGTTTGTCCTGGTCATGGACTTTAACTCGCTGTATCCGTCCATCATCCAGGAGTTTAACATTTGCTTCACG
ACGGTTGACAGGAACGGAGCGACAGACAACGACGACGACGACGACGCCGACGACGCCATCCCCGAGGTCCGCCCC
GATCAACCACAGGGCATCCTCCCCAAGCTCATCGCCACCCTCGTCGGCCGCAGACGACAAGTGAAGTCGCTCATG
AAGGACAAGAAAGCTACTCCCGAGCAGCTAGCCACATGGGACACCAAGCAGCTCGCCCTCAAGCTCACCGCCAAC
TCCATGTACGGCTGCCTCGGCTACACAAAGTCACGATTCTACGCCCGTCCTCTCGCCGTCCTCACAACATACAAA
GGCCGTGAGATCCTCTCCAGCACAAAGGAGCTGGCAGAGAGCAAATCACTACAAGTCATCTACGGCGACACCGAC
TCCGTCATGATCAACGCAAACGCCAGCTCCGTCGCCGACGCCCTCAAAGTCGGCAACGACTTCAAGCGCGCCGTC
AACGACCAGTACAAGCTCCTCGAGATCGACATCGACCACGTCTTCCGCCGCATACTCCTCCAAGCCAAGAAGAAG
TACGCCGCCGTCAGCCTCGTCGACGAGGGCGGCAGACTGGTCGAGCGCATGGAAGTCAAGGGTCTCGACATGAGG
CGTCGCGAGTACTGCGCTCTCTCCAAGGACGTCTCCAAGCATCTCCTCGACGACATCCTCTCGGGCGAAGAAGCC
GACATCGTCGTCAACCGCATCCACGCCCACCTCCGCGACACCGCCAGCGAGATGCGCCGGCGAAAAATCCCAACG
CCCAAATACATCATCTTCACCCAACTCGGCAAAGCACCCGCCGACTATCCCAACGCCGACTCCATGCCCCAGGTA
CAGGTCGCCCTCCGCGAATTAGCCCGCGGAAAGACCATCCGGAAGGGTGACGTCGTCTCCTACATCACCGTCTCC
GGAGACGGCCCCGCCCCGAAGCGGGCCCATGCCCCCGCCGACCTCCGCTCCGATGCCGACCTCGTCCCGGACGTC
GAGTGGTACATCGCCAAGCAGATCTTCCCTCCCGTCGAGCGTCTCTGCGCCCACATCGCCGGCACGTCAACAGCC
CAGCTAGCCGAACAGCTCGGCCTCGACATCCGCCGCTACCAAACCACCACCACCACCACCACCACCACCACCAAC
CCCTTGGACGCCGAACTCCACCCCTGGAGACTATCCCCCACCCGCGTCTCCCCCTCCGGCATCATCTGCCCCGAA
TGCCGCTCACCACTCCAGCCCATCTCGATAGTAGCCCAAGTCGAAGCCGCCATCCGCGCCCAGACGAGCAGCTAC
TACGAAGGCTGGCTGGTCTGCGACGACGCCCAGTGCGGAATCCGCACCCGCCAGATCAGCGTCTACGGCGCCCGC
TGCCTCGGCGGCAAGGGCCTCGCCCGCGGCGAATGCATGGGCCGTATGCGCTACCAGTACTCGGGCAAGGCCATT
TACAACCAGCTGCTCTACTACTCTGGTCTTTGGGACGTGGACAAGGCTGTTGCTGCTTGTGGCAACGACAACGAC
GACGACGACGTGCGAGCCCTCGCGGAGCAGAACCGCGTTCGGTTCGCGACGGTCAAGGCTGTCGTTGACGGCTAT
CTCGACAAGTGCGGTCGCCAGTGGGTGCCCATGGACACGCTATTTGCCCGCCTTGGCTTTCACAAGGCGATGGTG
ACTGGATGA
Transcript >Ophcf2|05674
ATGTCAAAAGCCAGTCGCAGGGCCAAGCTCGAGGAGCTTCGGGCCATGCGCCAGTCGGGCAAGAAGGCGTTTGAC
AACTACCAGGTGGACGAGGTCAAACCCGTCTACGACGAGGTGGATGATGAAGGATACAACAATGTGCTGCGAGAC
CGTCTCGAACGCGACGACTTTGTAGTCGATGACAATGGCCAAGGCTACGTCGATGACGGACGAGAGGAGTGGGAT
CATGCTCAGCCCGGCGACTCGGACAGCGAGGCCGGTGAAAGAGGCAGGCCGAGCAAGGCCGCCAAGAAGAAGCGA
AAAGACGAGCAGGACAAGCGGGCTGCCAACGATCGCAAAGTCAGCGACTACTTTACCCACGGAGCGGGAAGCACC
CAGAACAAGCCCAAGGTGGCTAAAACTAAAGAAGAGAGCGATTTCATGGACGGACTGCTCTCCGGGATCTCGTCC
AGCGTCGCCGACGCACCCCCTGTCTCCCTCTCGAGAAAGTCGAAATCCGACAAAGCCAGAAGCGCTCGCAAGTCC
AGGATTCTCTCGCCCGTTCTGGAACCGGCGTACAAAAAACAGAAGCGCGTCGATACCCGAGCTTCATCCCCCCCG
GCACCTGAGGACGTGGATATGGACGATGGCTTCACTCAGCTATTGGACGACGACGGGATCCTGGACGCTGGTGAT
GCCGCTATGAGCGACAATGTAGCTCCCTCTTCCCCCACGGCCAAGGTGGCGGAGCGGAAATCTCAGACGAAACAA
GAAGCAGGCGTCAAAGACGAGGATGAAGATGACGACTTGATGGAGGTTTCTCACGCCGGCGCACTCAAGACGGCG
AGCGTCAATATGGCAGCTTCTCGGCCTGTCAAGAAGCCGGTCGATCCGGTGCCCGACAGCTCCCCGAAGCCCGAA
GCCGCATCCGACGCCATCGACCCGACATCGTGGAAGGATCTCAACGACAGGCTCAATGTTATCAGTTCTCCTCCG
TCGGAAAGCCGGGGCATCGGAAAGATGGACCACAAGGACGCCATCGAGCCCGACGGCAGCCTCAACTTCTTCTGG
ATAGACTATGTCGAGGTCAACGGAAGTCTGTGTCTCTTTGGCAAGGTGCTCGACAAGAGGACCGAAGCCTACGTG
AGCTGCTTTGTCAAGGTAGACAACATGCTGAGGAAGCTCTATTTCTTGCCTCGTCAGCAGCGCGTGCTCGATGGC
CATGAAAGCGGTCAAGAGGTCACCATGTCGGACGTCTACGGTGAAGTGGACGACATGATGACGAAGATGAAGGTC
GACATGTACAAGATCAAGGCTTGTACGCGCAAGTACGCCTTTGAGCTGCCAGACGTGCCCAGGGAGGCCGAGTAC
TTGAAGCTGCTCTATCCCTACACCAAGCCGCAGATGGAGGCGAACAAACAGGGAGAGACGTTTTCTCGCGTGTTC
GGCACCAACACGGCCCTGTTCGAGCAGTTTGTCCTGTGGAAGAACATCATGGGCCCCTGCTGGCTCAAGATCCAG
GACGCCAACTTTGGCGCCCTCAAGAACGCGTCTCACTGCAAGCTCGAGGTGCTGGCGGAGCACCCGGACATGGTA
TCGACGACGACGGACGGCGACAAGGCCGAATGCCCGCCGCTGACGCTGATGAGCATCGCGCTCAGGACGGCCTTT
GACGCGAAGCAGAACCGGCAGGAGATTCTGGCCATCAGCGCCCGCATCTACGACAAGGTACAGCTGAGCGAGACG
ATGGCGGTGGAGGAGATGGCGTGTCGGACCTTTACCGTGATAAGGCCACACGGCCAGAGTTTCCCGCTGGGTTTT
GATCAGCTGGTGGCCAAGAGGAAGAGGGGGCTGATCGCGCTGAAGAAGCACGAGGGCGACCTCCTGAGCTTCTTC
CTGGCGCAGCTGGACGTTGCCGACCCGGACGTGATACTGGGCCACCAACTTGAGGGCGTCGACTACAGCGTACTC
CTGAACCGGCTGATGGACAGGAAGATCCACCAATGGTCCAGGCTCGGCCGGCTTCGGCGGACGCAGTGGCCGGCT
TCCATGGGCAAGATGGGCAGCAACGTCTTCGCAGAGCGGCAGGTCATGGCCGGACGGCTGCTGTGCGACGTCGGC
AACGACGCGGGCAAGGCCGTCATGGCCAAGTGCCAATCATGGAGCCTGACAGAGATGTGCAGCCTGTATCTGACG
AGCAACAACCGACGACGAGAGCTGGACAACGAGGCGGCTCTCAAGACGTGGGCGCGCGAGAAGCAGGGCCTGATG
GATTACATCGCCCACATGGAGGCCGACACGTACTTCGTCGCCGCCCTGGCTCTCGTCGTCCAGCTACTGCCCCTT
ACCAAAGTGCTCACCAACCTGGCCGGCAACTCGTGGGCGCGGACACTGACGGGAACGCGAGCCGAACGCAACGAG
TTCATCCTGCTTCACGAGTTCCATCGCAGCAAGTACATCTGCCCAGACAAGCCGTCGTTCCGCGGCCGGCAGAAG
GACGACGACGAGGCCAAGAAGAAGGATAACAAGTACAAGGGCGGCCTGGTGTTTGAGCCGCAAAAGGGGCTGTAC
GACAAGTTTGTCCTGGTCATGGACTTTAACTCGCTGTATCCGTCCATCATCCAGGAGTTTAACATTTGCTTCACG
ACGGTTGACAGGAACGGAGCGACAGACAACGACGACGACGACGACGCCGACGACGCCATCCCCGAGGTCCGCCCC
GATCAACCACAGGGCATCCTCCCCAAGCTCATCGCCACCCTCGTCGGCCGCAGACGACAAGTGAAGTCGCTCATG
AAGGACAAGAAAGCTACTCCCGAGCAGCTAGCCACATGGGACACCAAGCAGCTCGCCCTCAAGCTCACCGCCAAC
TCCATGTACGGCTGCCTCGGCTACACAAAGTCACGATTCTACGCCCGTCCTCTCGCCGTCCTCACAACATACAAA
GGCCGTGAGATCCTCTCCAGCACAAAGGAGCTGGCAGAGAGCAAATCACTACAAGTCATCTACGGCGACACCGAC
TCCGTCATGATCAACGCAAACGCCAGCTCCGTCGCCGACGCCCTCAAAGTCGGCAACGACTTCAAGCGCGCCGTC
AACGACCAGTACAAGCTCCTCGAGATCGACATCGACCACGTCTTCCGCCGCATACTCCTCCAAGCCAAGAAGAAG
TACGCCGCCGTCAGCCTCGTCGACGAGGGCGGCAGACTGGTCGAGCGCATGGAAGTCAAGGGTCTCGACATGAGG
CGTCGCGAGTACTGCGCTCTCTCCAAGGACGTCTCCAAGCATCTCCTCGACGACATCCTCTCGGGCGAAGAAGCC
GACATCGTCGTCAACCGCATCCACGCCCACCTCCGCGACACCGCCAGCGAGATGCGCCGGCGAAAAATCCCAACG
CCCAAATACATCATCTTCACCCAACTCGGCAAAGCACCCGCCGACTATCCCAACGCCGACTCCATGCCCCAGGTA
CAGGTCGCCCTCCGCGAATTAGCCCGCGGAAAGACCATCCGGAAGGGTGACGTCGTCTCCTACATCACCGTCTCC
GGAGACGGCCCCGCCCCGAAGCGGGCCCATGCCCCCGCCGACCTCCGCTCCGATGCCGACCTCGTCCCGGACGTC
GAGTGGTACATCGCCAAGCAGATCTTCCCTCCCGTCGAGCGTCTCTGCGCCCACATCGCCGGCACGTCAACAGCC
CAGCTAGCCGAACAGCTCGGCCTCGACATCCGCCGCTACCAAACCACCACCACCACCACCACCACCACCACCAAC
CCCTTGGACGCCGAACTCCACCCCTGGAGACTATCCCCCACCCGCGTCTCCCCCTCCGGCATCATCTGCCCCGAA
TGCCGCTCACCACTCCAGCCCATCTCGATAGTAGCCCAAGTCGAAGCCGCCATCCGCGCCCAGACGAGCAGCTAC
TACGAAGGCTGGCTGGTCTGCGACGACGCCCAGTGCGGAATCCGCACCCGCCAGATCAGCGTCTACGGCGCCCGC
TGCCTCGGCGGCAAGGGCCTCGCCCGCGGCGAATGCATGGGCCGTATGCGCTACCAGTACTCGGGCAAGGCCATT
TACAACCAGCTGCTCTACTACTCTGGTCTTTGGGACGTGGACAAGGCTGTTGCTGCTTGTGGCAACGACAACGAC
GACGACGACGTGCGAGCCCTCGCGGAGCAGAACCGCGTTCGGTTCGCGACGGTCAAGGCTGTCGTTGACGGCTAT
CTCGACAAGTGCGGTCGCCAGTGGGTGCCCATGGACACGCTATTTGCCCGCCTTGGCTTTCACAAGGCGATGGTG
ACTGGATGA
Gene >Ophcf2|05674
ATGTCAAAAGCCAGTCGCAGGGCCAAGCTCGAGGAGCTTCGGGCCATGCGCCAGTCGGGCAAGAAGGCGTTTGAC
AACTACCAGGTGGACGAGGTCAAACCCGTCTACGACGAGGTGGATGATGAAGGATACAACAATGTGCTGCGAGAC
CGTCTCGAACGCGACGACTTTGTAGTCGATGACAATGGCCAAGGCTACGTCGATGACGGACGAGAGGAGTGGGAT
CATGCTCAGCCCGGCGACTCGGACAGCGAGGCCGGTGAAAGAGGCAGGCCGAGCAAGGCCGGTACGTGACTAGTC
GCTCCGGATTGACGCTATATTTGCTTATATCATGCGAAGCCAAGAAGAAGCGAAAAGACGAGCAGGACAAGCGGG
CTGCCAACGATCGCAAAGTCAGCGACTACTTTACCCACGGAGCGGGAAGCACCCAGAACAAGCCCAAGGTGTGTT
GTTAACGAATTGGTGAGAATTAGATGCTAATGATAGGCTCCAGGTGGCTAAAACTAAAGAAGAGAGCGATTTCAT
GGACGGACTGCTCTCCGGGATCTCGTCCAGCGTCGCCGACGCACCCCCTGTCTCCCTCTCGAGAAAGTCGAAATC
CGACAAAGCCAGAAGCGCTCGCAAGTCCAGGATTCTCTCGCCCGTTCTGGAACCGGCGTACAAAAAACAGAAGCG
CGTCGATACCCGAGCTTCATCCCCCCCGGCACCTGAGGACGTGGATATGGACGATGGCTTCACTCAGCTATTGGA
CGACGACGGGATCCTGGACGCTGGTGATGCCGCTATGAGCGACAATGTAGCTCCCTCTTCCCCCACGGCCAAGGT
GGCGGAGCGGAAATCTCAGACGAAACAAGAAGCAGGCGTCAAAGACGAGGATGAAGATGACGACTTGATGGAGGT
TTCTCACGCCGGCGCACTCAAGACGGCGAGCGTCAATATGGCAGCTTCTCGGCCTGTCAAGAAGCCGGTCGATCC
GGTGCCCGACAGCTCCCCGAAGCCCGAAGCCGCATCCGACGCCATCGACCCGACATCGTGGAAGGATCTCAACGA
CAGGCTCAATGTTATCAGTTCTCCTCCGTCGGAAAGCCGGGGCATCGGAAAGATGGACCACAAGGACGCCATCGA
GCCCGACGGCAGCCTCAACTTCTTCTGGATAGACTATGTCGAGGTCAACGGAAGTCTGTGTCTCTTTGGCAAGGT
GCTCGACAAGAGGACCGAAGCCTACGTGAGCTGCTTTGTCAAGGTAGACAACATGCTGAGGAAGCTCTATTTCTT
GCCTCGTCAGCAGCGCGTGCTCGATGGCCATGAAAGCGGTCAAGAGGTCACCATGTCGGACGTCTACGGTGAAGT
GGACGACATGATGACGAAGATGAAGGTCGACATGTACAAGATCAAGGCTTGTACGCGCAAGTACGCCTTTGAGCT
GCCAGACGTGCCCAGGGAGGCCGAGTACTTGAAGCTGCTCTATCCCTACACCAGTGAGTATCGTCTGAGGCTGGG
GAGGCGGCCGATGCTGACGAAAGGGGAACAGAGCCGCAGATGGAGGCGAACAAACAGGGAGAGACGTTTTCTCGC
GTGTTCGGCACCAACACGGCCCTGTTCGAGCAGTTTGTCCTGTGGAAGAACATCATGGGCCCCTGCTGGCTCAAG
ATCCAGGACGCCAACTTTGGCGCCCTCAAGAACGCGTCTCACTGCAAGCTCGAGGTGCTGGCGGAGCACCCGGAC
ATGGTATCGACGACGACGGACGGCGACAAGGCCGAATGCCCGCCGCTGACGCTGATGAGCATCGCGCTCAGGACG
GCCTTTGACGCGAAGCAGAACCGGCAGGAGATTCTGGCCATCAGCGCCCGCATCTACGACAAGGTACAGCTGAGC
GAGACGATGGCGGTGGAGGAGATGGCGTGTCGGACCTTTACCGTGATAAGGCCACACGGCCAGAGTTTCCCGCTG
GGTTTTGATCAGCTGGTGGCCAAGAGGAAGAGGGGGCTGATCGCGCTGAAGAAGCACGAGGGCGACCTCCTGAGC
TTCTTCCTGGCGCAGCTGGACGTTGCCGACCCGGACGTGATACTGGGCCACCAACTTGAGGGCGTCGACTACAGC
GTACTCCTGAACCGGCTGATGGACAGGAAGATCCACCAATGGTCCAGGCTCGGCCGGCTTCGGCGGACGCAGTGG
CCGGCTTCCATGGGCAAGATGGGCAGCAACGTCTTCGCAGAGCGGCAGGTCATGGCCGGACGGCTGCTGTGCGAC
GTCGGCAACGACGCGGGCAAGGCCGTCATGGCCAAGTGCCAATCATGGAGCCTGACAGAGATGTGCAGCCTGTAT
CTGACGAGCAACAACCGACGACGAGAGCTGGACAACGAGGCGGCTCTCAAGACGTGGGCGCGCGAGAAGCAGGGC
CTGATGGATTACATCGCCCACATGGAGGCCGACACGTACTTCGTCGCCGCCCTGGCTCTCGTCGTCCAGCTACTG
CCCCTTACCAAAGTGCTCACCAACCTGGCCGGCAACTCGTGGGCGCGGACACTGACGGGAACGCGAGCCGAACGC
AACGAGTTCATCCTGCTTCACGAGTTCCATCGCAGCAAGTACATCTGCCCAGACAAGCCGTCGTTCCGCGGCCGG
CAGAAGGACGACGACGAGGCCAAGAAGAAGGATAACAAGTACAAGGGCGGCCTGGTGTTTGAGCCGCAAAAGGGG
CTGTACGACAAGTTTGTCCTGGTCATGGACTTTAACTCGCTGTATCCGTCCATCATCCAGGAGTTTAACATTTGC
TTCACGACGGTTGACAGGAACGGAGCGGTAAGCTCTCCATCTTGCTCCTTTGCCCCTTCTTCTTCACCATCTGCT
GACTACCCCTGCTTTCTTCACAGACAGACAACGACGACGACGACGACGCCGACGACGCCATCCCCGAGGTCCGCC
CCGATCAACCACAGGGCATCCTCCCCAAGCTCATCGCCACCCTCGTCGGCCGCAGACGACAAGTGAAGTCGCTCA
TGAAGGACAAGAAAGCTACTCCCGAGCAGCTAGCCACATGGGACACCAAGCAGCTCGCCCTCAAGCTCACCGCCA
ACTCCATGTACGGCTGCCTCGGCTACACAAAGTCACGATTCTACGCCCGTCCTCTCGCCGTCCTCACAACATACA
AAGGCCGTGAGATCCTCTCCAGCACAAAGGAGCTGGCAGAGAGCAAATCACTACAAGTCATCTACGGCGACACCG
ACTCCGTCATGATCAACGCAAACGCCAGCTCCGTCGCCGACGCCCTCAAAGTCGGCAACGACTTCAAGCGCGCCG
TCAACGACCAGTACAAGCTCCTCGAGATCGACATCGACCACGTCTTCCGCCGCATACTCCTCCAAGCCAAGAAGA
AGTACGCCGCCGTCAGCCTCGTCGACGAGGGCGGCAGACTGGTCGAGCGCATGGAAGTCAAGGGTCTCGACATGA
GGCGTCGCGAGTACTGCGCTCTCTCCAAGGACGTCTCCAAGCATCTCCTCGACGACATCCTCTCGGGCGAAGAAG
CCGACATCGTCGTCAACCGCATCCACGCCCACCTCCGCGACACCGCCAGCGAGATGCGCCGGCGAAAAATCCCAA
CGCCCAAATACATCATCTTCACCCAACTCGGCAAAGCACCCGCCGACTATCCCAACGCCGACTCCATGCCCCAGG
TACAGGTCGCCCTCCGCGAATTAGCCCGCGGAAAGACCATCCGGAAGGGTGACGTCGTCTCCTACATCACCGTCT
CCGGAGACGGCCCCGCCCCGAAGCGGGCCCATGCCCCCGCCGACCTCCGCTCCGATGCCGACCTCGTCCCGGACG
TCGAGTGGTACATCGCCAAGCAGATCTTCCCTCCCGTCGAGCGTCTCTGCGCCCACATCGCCGGCACGTCAACAG
CCCAGCTAGCCGAACAGCTCGGCCTCGACATCCGCCGCTACCAAACCACCACCACCACCACCACCACCACCACCA
ACCCCTTGGACGCCGAACTCCACCCCTGGAGTCCCAGATGACAGACTCAGTCCGCTTCGCCGACTGCGCCCGCCT
CACCCTCCGCTGCCGCCGCTGCAAAACAAGCTCCCCCTTCGAAGGACTATCCCCCACCCGCGTCTCCCCCTCCGG
CATCATCTGCCCCGAATGCCGCTCACCACTCCAGCCCATCTCGATAGTAGCCCAAGTCGAAGCCGCCATCCGCGC
CCAGACGAGCAGCTACTACGAAGGCTGGCTGGTCTGCGACGACGCCCAGTGCGGAATCCGCACCCGCCAGATCAG
CGTCTACGGCGCCCGCTGCCTCGGCGGCAAGGGCCTCGCCCGCGGCGAATGCATGGGCCGTATGCGCTACCAGTA
CTCGGGCAAGGCCATTTACAACCAGCTGCTCTACTACTCTGGTCTTTGGGACGTGGACAAGGCTGTTGCTGCTTG
TGGCAACGACAACGACGACGACGACGTGCGAGCCCTCGCGGAGCAGAACCGCGTTCGGTTCGCGACGGTCAAGGC
TGTCGTTGACGGCTATCTCGACAAGTGCGGTCGCCAGTGGGTGCCCATGGACACGCTATTTGCCCGCCTTGGCTT
TCACAAGGCGATGGTGACTGGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail