Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05664
Gene name
Locationscaffold_06:1931408..1932541
Strand+
Gene length (bp)1133
Transcript length (bp)738
Coding sequence length (bp)738
Protein length (aa) 246

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00153 Mito_carr Mitochondrial carrier protein 2.7E-20 5 96
PF00153 Mito_carr Mitochondrial carrier protein 1.3E-17 108 202

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 4 26 22
2 67 89 22
3 109 131 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05664
MSTTLGAFIAGGIAACGAVTATHPFETVKIRMQLQGELQSKGHQPHHYRGPFHGVSVIVKHEGVRGLYRGLGCAY
VYQILLNGCRLGFYDPMRNCLGSLIFNDKNAQNLAINMFCGASSGVIGAAAGSPFFLVKTRLQSYSPFLPVGTQH
QYRNAWDGMSKIYRSEGLAGLYRGAGAAMIRTGFGSSVQLPTYFFAKRRLIQHAGMEEGPALHLASSTVSGFVVC
CVMHPPDTIMSRLYNQNAKA*
Coding >Ophcf2|05664
ATGTCCACTACATTAGGGGCCTTCATCGCCGGTGGCATTGCGGCCTGTGGTGCCGTTACCGCGACTCACCCTTTC
GAGACAGTCAAGATCCGTATGCAATTGCAAGGCGAGCTCCAATCCAAGGGCCATCAGCCGCATCATTATCGTGGA
CCCTTCCACGGCGTCAGTGTCATTGTGAAGCACGAGGGAGTTCGGGGCTTATATCGCGGTCTGGGCTGCGCATAC
GTCTACCAAATACTCCTCAACGGCTGCCGGCTCGGCTTTTACGATCCCATGCGCAATTGTCTGGGATCCCTAATC
TTCAACGACAAGAATGCGCAAAACCTGGCCATCAACATGTTCTGCGGCGCCTCCTCGGGCGTCATCGGAGCCGCA
GCCGGGAGCCCCTTTTTTCTGGTCAAAACACGCCTCCAGAGCTATTCGCCTTTTCTTCCTGTCGGCACGCAGCAC
CAATATCGGAACGCATGGGATGGCATGTCGAAGATCTACCGCAGCGAGGGTCTCGCCGGCCTCTACCGCGGTGCC
GGTGCAGCCATGATTCGCACCGGTTTTGGAAGCTCCGTCCAGCTACCGACTTATTTCTTCGCCAAGCGACGACTC
ATTCAACACGCCGGAATGGAAGAAGGGCCGGCCTTGCACCTCGCCAGTAGCACCGTCAGCGGATTCGTCGTCTGC
TGCGTCATGCATCCTCCTGACACAATAATGTCTCGTCTGTACAATCAGAATGCCAAAGCATAG
Transcript >Ophcf2|05664
ATGTCCACTACATTAGGGGCCTTCATCGCCGGTGGCATTGCGGCCTGTGGTGCCGTTACCGCGACTCACCCTTTC
GAGACAGTCAAGATCCGTATGCAATTGCAAGGCGAGCTCCAATCCAAGGGCCATCAGCCGCATCATTATCGTGGA
CCCTTCCACGGCGTCAGTGTCATTGTGAAGCACGAGGGAGTTCGGGGCTTATATCGCGGTCTGGGCTGCGCATAC
GTCTACCAAATACTCCTCAACGGCTGCCGGCTCGGCTTTTACGATCCCATGCGCAATTGTCTGGGATCCCTAATC
TTCAACGACAAGAATGCGCAAAACCTGGCCATCAACATGTTCTGCGGCGCCTCCTCGGGCGTCATCGGAGCCGCA
GCCGGGAGCCCCTTTTTTCTGGTCAAAACACGCCTCCAGAGCTATTCGCCTTTTCTTCCTGTCGGCACGCAGCAC
CAATATCGGAACGCATGGGATGGCATGTCGAAGATCTACCGCAGCGAGGGTCTCGCCGGCCTCTACCGCGGTGCC
GGTGCAGCCATGATTCGCACCGGTTTTGGAAGCTCCGTCCAGCTACCGACTTATTTCTTCGCCAAGCGACGACTC
ATTCAACACGCCGGAATGGAAGAAGGGCCGGCCTTGCACCTCGCCAGTAGCACCGTCAGCGGATTCGTCGTCTGC
TGCGTCATGCATCCTCCTGACACAATAATGTCTCGTCTGTACAATCAGAATGCCAAAGCATAG
Gene >Ophcf2|05664
ATGTCCACTACATTAGGGTTTGTTTGAGGATATAGCTGTACTCGCTGTGCAACCGACTTAAATTGTCTTTCTTCT
CCAGGGCCTTCATCGCCGGTGGCATTGCGGCCTGTGGTGCCGTTACCGCGACTCACCCTTTCGAGACAGTCAAGA
TCCGGTAATTGGGCGCCGCCAGATCCCCCCCTTGCGTGGATTTGGCGACCTGACAGCGGCTTTGACCGGCAGTAT
GCAATTGCAAGGCGAGCTCCAATCCAAGGGCCATCAGCCGCATCATTATCGTGGACCCTTCCACGGCGTCAGTGT
CATTGTGAAGCACGAGGGAGTTCGGGGCTTATATCGCGGTCTGGGCTGCGCATACGTCTACCAAATACTCCTCAA
CGGCTGCCGGCTCGGCTTTTACGATCCCATGCGCAATTGTCTGGGATCCCTAATCTTCAACGACAAGAATGCGCA
AAACCTGGCCATCAACATGTTCTGCGGCGCCTCCTCGGGCGTCATCGGAGCCGCAGCCGGGAGCCCCTTTTTTCT
GGTCAAAACACGCCTCCAGAGCTATTCGCCTTTTCTTCCTGTCGGCACGCAGCACCAATATCGGAACGCATGGGA
TGGCATGTCGAAGATCTACCGCAGCGAGGGTCTCGCCGGCCTCTACCGCGGTGCCGGTGCAGCCATGATTCGCAC
CGGTTTTGGAAGCTCCGTCCAGCTACCGACTTATTTCTTCGCCAAGCGACGACTCATTCAACACGCCGGAATGGA
AGAAGGGCCGGCCTTGCACCTCGCCAGTAGCACCGTCAGCGGATTCGTCGTCTGCTGCGTCATGCATCCTCCTGG
TAAGAGGCCGTCATCCCTTCCGTCGTGGCCATGAAGACGGGATAGCTAACGCTCGCTGTTACTCACCCATCAAAG
ACACAATAATGTCTCGTCTGTACAATCAGAATGGTAACTTGTACAAGGGAGTCTTTGACTGTCTGGCAAAGACTA
TACGCACCGAAGGCTTCCTTGCGATCTATAAGGGCTTTCTCCCACATTTGGCCCGGATATTGCCACATACAATCC
TCACCCTCTCCCTTGCCGAGCAAACGAATAAATTAATGAGAAGAGTCGAAGGTCGCGTTCTGCCCATGCTAGCCA
AAGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail