Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05662
Gene name
Locationscaffold_06:1928449..1929001
Strand-
Gene length (bp)552
Transcript length (bp)495
Coding sequence length (bp)495
Protein length (aa) 165

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05486 SRP9-21 Signal recognition particle 9 kDa protein (SRP9) 5.6E-34 4 97

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4233 0.765 0.0526 0.0332 0.1455 0.0027 0.0942 0.0206 0.0974 0.0296

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5284
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2339
Ophiocordyceps australis map64 (Brazil) OphauB2|816
Ophiocordyceps camponoti-floridani Ophcf2|05662 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|818
Ophiocordyceps kimflemingae Ophio5|6267
Ophiocordyceps subramaniannii Hirsu2|4704

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05662
MPYFPTSQEWLDQSTLLLEARPMTTRVTTRYSIKAVKPSREKNPTDKDNETPRPPRASLVLKTYDPVSGVTLKYR
TTKAAEVSRLVHASLGRLARKMAALPDAANAVDNAGGLPEELMSDAPPPAELDAASAMSGREGKDVQGSASRQQP
QVGGVGHKKKKGRR*
Coding >Ophcf2|05662
ATGCCTTACTTTCCAACGAGTCAGGAGTGGCTCGATCAGTCCACCCTCCTCCTCGAAGCACGGCCCATGACCACG
CGCGTGACGACACGCTACTCCATCAAGGCCGTCAAACCCTCGCGCGAGAAAAACCCAACAGACAAGGACAACGAA
ACGCCAAGGCCCCCCCGCGCCTCTCTCGTCCTCAAGACGTACGACCCCGTCAGCGGCGTGACGCTCAAGTACCGC
ACCACCAAAGCCGCCGAGGTCTCGCGCCTCGTCCACGCGTCGCTGGGGAGGCTGGCTAGGAAAATGGCCGCCTTG
CCCGATGCCGCTAATGCTGTTGATAACGCTGGTGGCTTGCCGGAGGAGCTGATGTCTGATGCGCCGCCACCTGCC
GAGCTGGATGCGGCGAGCGCGATGAGCGGCAGGGAGGGCAAGGATGTGCAGGGTTCGGCTTCCAGACAGCAACCG
CAGGTTGGCGGAGTTGGTCATAAGAAGAAGAAGGGCCGCAGATAA
Transcript >Ophcf2|05662
ATGCCTTACTTTCCAACGAGTCAGGAGTGGCTCGATCAGTCCACCCTCCTCCTCGAAGCACGGCCCATGACCACG
CGCGTGACGACACGCTACTCCATCAAGGCCGTCAAACCCTCGCGCGAGAAAAACCCAACAGACAAGGACAACGAA
ACGCCAAGGCCCCCCCGCGCCTCTCTCGTCCTCAAGACGTACGACCCCGTCAGCGGCGTGACGCTCAAGTACCGC
ACCACCAAAGCCGCCGAGGTCTCGCGCCTCGTCCACGCGTCGCTGGGGAGGCTGGCTAGGAAAATGGCCGCCTTG
CCCGATGCCGCTAATGCTGTTGATAACGCTGGTGGCTTGCCGGAGGAGCTGATGTCTGATGCGCCGCCACCTGCC
GAGCTGGATGCGGCGAGCGCGATGAGCGGCAGGGAGGGCAAGGATGTGCAGGGTTCGGCTTCCAGACAGCAACCG
CAGGTTGGCGGAGTTGGTCATAAGAAGAAGAAGGGCCGCAGATAA
Gene >Ophcf2|05662
ATGCCTTACTTTCCAACGAGTCAGGAGTGGCTCGATCAGTCCACCCTCCTCCTCGAAGCACGGCCCATGACCGTA
AACTCCCCTTTCCTCTACAAACAAGACAGAGCGACAGCTGACGAGAACTCCCAGACGCGCGTGACGACACGCTAC
TCCATCAAGGCCGTCAAACCCTCGCGCGAGAAAAACCCAACAGACAAGGACAACGAAACGCCAAGGCCCCCCCGC
GCCTCTCTCGTCCTCAAGACGTACGACCCCGTCAGCGGCGTGACGCTCAAGTACCGCACCACCAAAGCCGCCGAG
GTCTCGCGCCTCGTCCACGCGTCGCTGGGGAGGCTGGCTAGGAAAATGGCCGCCTTGCCCGATGCCGCTAATGCT
GTTGATAACGCTGGTGGCTTGCCGGAGGAGCTGATGTCTGATGCGCCGCCACCTGCCGAGCTGGATGCGGCGAGC
GCGATGAGCGGCAGGGAGGGCAAGGATGTGCAGGGTTCGGCTTCCAGACAGCAACCGCAGGTTGGCGGAGTTGGT
CATAAGAAGAAGAAGGGCCGCAGATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail