Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05661
Gene name
Locationscaffold_06:1926638..1928063
Strand+
Gene length (bp)1425
Transcript length (bp)1251
Coding sequence length (bp)1251
Protein length (aa) 417

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00268 Ribonuc_red_sm Ribonucleotide reductase, small chain 5.8E-119 90 358

GO

GO Term Description Terminal node
GO:0009263 deoxyribonucleotide biosynthetic process Yes
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0044281 small molecule metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0008152 metabolic process No
GO:0009165 nucleotide biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009987 cellular process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0090407 organophosphate biosynthetic process No
GO:0009117 nucleotide metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0009262 deoxyribonucleotide metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0008150 biological_process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0019637 organophosphate metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

Domain # Start End Length
1 236 258 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05661
MTAHVTPSKQAASAIESLKMETPVKKLDFGAADKENRPLDESADADADASSEPATHVAKDAVKKVEQTAVVAGIK
PEEADEPLLQENPQRFVLFPIKYHEIWAMYKKAEASFWTAEEIDLSKDLHDWNNRINDDEKYFISHILAFFAASD
GIVNENLVERFSGEVQIPEARCFYGFQIMMENIHSETYSLLIDTYIKEHAQRTYLFNAIETIPCIRKKADWAIRW
IQDKDSSFAQRLVAFAAVEGIFFSGAFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLHSHLKKRASKEV
ILDIITDAVTIEQEFLTEALPCALLGMNANLMKQYIEFVADRLLVALGNEKVYKSANPFDFMENISLGGKTNFFE
KRVADYQKAGVMASTKKNADDGTASTDNKVEDGDFTFDDDF*
Coding >Ophcf2|05661
ATGACTGCCCACGTCACCCCTTCCAAGCAGGCTGCCTCGGCCATAGAGTCGCTCAAGATGGAGACTCCCGTCAAG
AAACTCGACTTCGGTGCCGCCGATAAGGAGAACCGGCCCCTCGACGAGTCCGCCGACGCCGACGCCGACGCCTCA
TCGGAGCCTGCCACTCACGTTGCCAAGGATGCCGTCAAGAAGGTCGAGCAGACGGCTGTCGTTGCCGGCATCAAG
CCCGAAGAGGCCGACGAGCCACTTCTGCAGGAGAATCCTCAGCGATTTGTCCTGTTCCCTATCAAATATCACGAG
ATCTGGGCCATGTACAAAAAAGCAGAAGCCTCCTTCTGGACGGCCGAGGAGATTGACCTCTCCAAGGACCTGCAC
GACTGGAACAACCGCATCAATGATGACGAAAAGTACTTTATCTCGCACATTCTCGCCTTCTTTGCCGCCTCCGAC
GGCATCGTCAACGAGAACCTCGTGGAGCGGTTCAGCGGCGAGGTTCAGATCCCTGAAGCCCGCTGTTTCTACGGT
TTCCAGATTATGATGGAGAACATACATTCCGAGACGTACTCGCTCTTGATTGACACTTACATTAAAGAGCACGCC
CAACGGACCTATCTCTTCAATGCCATCGAGACCATTCCCTGCATCCGCAAAAAGGCCGACTGGGCCATTCGCTGG
ATTCAAGACAAGGACTCGTCCTTTGCTCAGCGTCTGGTGGCCTTTGCCGCGGTTGAGGGCATCTTCTTCAGTGGC
GCTTTCGCTTCCATATTCTGGCTCAAGAAGCGCGGGCTCATGCCCGGACTGACCTTTTCCAACGAGCTCATCTCG
CGCGATGAGGGTCTGCATACCGACTTTGCCTGCCTGCTGCACTCTCACCTGAAGAAGCGAGCCAGCAAAGAGGTG
ATTCTCGACATCATCACCGACGCCGTCACCATTGAGCAGGAGTTCCTTACAGAGGCCCTGCCTTGCGCCCTCCTC
GGCATGAACGCCAATCTGATGAAGCAGTACATTGAGTTTGTCGCCGACCGCCTGCTCGTCGCTCTCGGCAATGAA
AAGGTCTACAAGTCGGCCAATCCCTTCGACTTCATGGAGAACATTTCTCTTGGCGGCAAGACCAACTTCTTCGAG
AAGCGCGTAGCAGACTATCAAAAGGCCGGCGTCATGGCCAGCACCAAGAAGAACGCCGACGATGGCACAGCTTCG
ACTGATAACAAGGTCGAGGACGGCGACTTCACCTTTGACGACGACTTTTGA
Transcript >Ophcf2|05661
ATGACTGCCCACGTCACCCCTTCCAAGCAGGCTGCCTCGGCCATAGAGTCGCTCAAGATGGAGACTCCCGTCAAG
AAACTCGACTTCGGTGCCGCCGATAAGGAGAACCGGCCCCTCGACGAGTCCGCCGACGCCGACGCCGACGCCTCA
TCGGAGCCTGCCACTCACGTTGCCAAGGATGCCGTCAAGAAGGTCGAGCAGACGGCTGTCGTTGCCGGCATCAAG
CCCGAAGAGGCCGACGAGCCACTTCTGCAGGAGAATCCTCAGCGATTTGTCCTGTTCCCTATCAAATATCACGAG
ATCTGGGCCATGTACAAAAAAGCAGAAGCCTCCTTCTGGACGGCCGAGGAGATTGACCTCTCCAAGGACCTGCAC
GACTGGAACAACCGCATCAATGATGACGAAAAGTACTTTATCTCGCACATTCTCGCCTTCTTTGCCGCCTCCGAC
GGCATCGTCAACGAGAACCTCGTGGAGCGGTTCAGCGGCGAGGTTCAGATCCCTGAAGCCCGCTGTTTCTACGGT
TTCCAGATTATGATGGAGAACATACATTCCGAGACGTACTCGCTCTTGATTGACACTTACATTAAAGAGCACGCC
CAACGGACCTATCTCTTCAATGCCATCGAGACCATTCCCTGCATCCGCAAAAAGGCCGACTGGGCCATTCGCTGG
ATTCAAGACAAGGACTCGTCCTTTGCTCAGCGTCTGGTGGCCTTTGCCGCGGTTGAGGGCATCTTCTTCAGTGGC
GCTTTCGCTTCCATATTCTGGCTCAAGAAGCGCGGGCTCATGCCCGGACTGACCTTTTCCAACGAGCTCATCTCG
CGCGATGAGGGTCTGCATACCGACTTTGCCTGCCTGCTGCACTCTCACCTGAAGAAGCGAGCCAGCAAAGAGGTG
ATTCTCGACATCATCACCGACGCCGTCACCATTGAGCAGGAGTTCCTTACAGAGGCCCTGCCTTGCGCCCTCCTC
GGCATGAACGCCAATCTGATGAAGCAGTACATTGAGTTTGTCGCCGACCGCCTGCTCGTCGCTCTCGGCAATGAA
AAGGTCTACAAGTCGGCCAATCCCTTCGACTTCATGGAGAACATTTCTCTTGGCGGCAAGACCAACTTCTTCGAG
AAGCGCGTAGCAGACTATCAAAAGGCCGGCGTCATGGCCAGCACCAAGAAGAACGCCGACGATGGCACAGCTTCG
ACTGATAACAAGGTCGAGGACGGCGACTTCACCTTTGACGACGACTTTTGA
Gene >Ophcf2|05661
ATGACTGCCCACGTCACCCCTTCCAAGCAGGTCAGTGGCGTCGCCTGGCTCGCCCGTGTCATTGATGTAAACTGA
CCGCGCGCTTGCCACAGGCTGCCTCGGCCATAGAGTCGCTCAAGATGGAGACTCCCGTCAAGAAACTCGACTTCG
GTGCCGCCGATAAGGAGAACCGGCCCCTCGACGAGTCCGCCGACGCCGACGCCGACGCCTCATCGGAGCCTGCCA
CTCACGTTGCCAAGGATGCCGTCAAGAAGGTCGAGCAGACGGCTGTCGTTGCCGGCATCAAGCCCGAAGAGGCCG
ACGAGCCACTTCTGCAGGAGAATCCTCAGCGATTTGTCCTGTTCCCTATCAAATATCACGAGGTGAGAGACGCGC
CTCAACCTGAGTACGTCAAGTGCTTAACCCTTCCTAGATCTGGGCCATGTACAAAAAAGCAGAAGCCTCCTTCTG
GACGGCCGAGGAGATTGACCTCTCCAAGGACCTGCACGACTGGAACAACCGCATCAATGATGACGAAAAGTACTT
TATCTCGCACATTCTCGCCTTCTTTGCCGCCTCCGACGGCATCGTCAACGAGAACCTCGTGGAGCGGTTCAGCGG
CGAGGTTCAGATCCCTGAAGCCCGCTGTTTCTACGGTTTCCAGATTATGATGGAGAACATACATTCCGAGACGTA
CTCGCTCTTGATTGACACTTACATTAAAGAGCACGCCCAACGGACCTATCTCTTCAATGCCATCGAGACCAGTAT
GTTCTGATCCCTCGAGTATCCCGCGCTGCGAGTTTCGGTTGTTGACATGATAAAACAGTTCCCTGCATCCGCAAA
AAGGCCGACTGGGCCATTCGCTGGATTCAAGACAAGGACTCGTCCTTTGCTCAGCGTCTGGTGGCCTTTGCCGCG
GTTGAGGGCATCTTCTTCAGTGGCGCTTTCGCTTCCATATTCTGGCTCAAGAAGCGCGGGCTCATGCCCGGACTG
ACCTTTTCCAACGAGCTCATCTCGCGCGATGAGGGTCTGCATACCGACTTTGCCTGCCTGCTGCACTCTCACCTG
AAGAAGCGAGCCAGCAAAGAGGTGATTCTCGACATCATCACCGACGCCGTCACCATTGAGCAGGAGTTCCTTACA
GAGGCCCTGCCTTGCGCCCTCCTCGGCATGAACGCCAATCTGATGAAGCAGTACATTGAGTTTGTCGCCGACCGC
CTGCTCGTCGCTCTCGGCAATGAAAAGGTCTACAAGTCGGCCAATCCCTTCGACTTCATGGAGAACATTTCTCTT
GGCGGCAAGACCAACTTCTTCGAGAAGCGCGTAGCAGACTATCAAAAGGCCGGCGTCATGGCCAGCACCAAGAAG
AACGCCGACGATGGCACAGCTTCGACTGATAACAAGGTCGAGGACGGCGACTTCACCTTTGACGACGACTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail