Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05655
Gene name
Locationscaffold_06:1912307..1914566
Strand+
Gene length (bp)2259
Transcript length (bp)1713
Coding sequence length (bp)1713
Protein length (aa) 571

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06814 Lung_7-TM_R Lung seven transmembrane receptor 1.0E-69 179 468

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.5

Transmembrane Domains

Domain # Start End Length
1 218 240 22
2 252 271 19
3 286 308 22
4 329 348 19
5 358 380 22
6 401 423 22
7 438 460 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05655
MFILATPISLSFQSSPTGDEASLRLSNAQKRLLRMKLLSGLCVLGLLAWTTRALEVGMDQTEKNRQYCSGMYSRT
TWGGPVDPFIEIKFLNSTIPDGSDPIASLIIFEWADKNLVGVPDPDVPGLQLELCHDESAQQGRCNASSIGEFII
SPNATRKSNAIILSKAVHLKESVPIRYAIKKTGYYCVVTEVFTAEQYSLVTEFRNAYGELPATQIPKLPFYGGMT
ILYALVCVFWGFLYYQHRHDILAVQNYITAILIFLVIEMLMTWGFYDYQNRIGNNAVSKVLLIVVGILNAARNSF
SFFLLLIVCMGYGVVKPTLGRTMIHVRWLAAAHFVFGLVYAITSLLISPESAGPFVLLIVLPLAGTLTGFYVWTL
NSLNFTLKDLRERKQYAKEAMYKKLWWSILVSILVIFAFFFFNSFTFASVNDPDFVPFHWKTRWFVLDGWLNIVY
FGDVVWIAYVWRPTANNRRFAMSDEIAQDDDGNFEIGDIGIPEDFEDEEEAHGGHHQRHLPPVTGITSAGPAADS
QQRGQNRGPGRESLEAETIFAVGEDGDKLSDVGSEEEDATLVQAK*
Coding >Ophcf2|05655
ATGTTTATTCTTGCAACCCCCATTTCCCTATCCTTTCAATCCTCACCAACTGGCGACGAAGCTTCTCTGCGCCTG
TCGAACGCGCAGAAGCGACTGCTCAGGATGAAGCTTCTTTCGGGCCTCTGCGTTCTGGGCCTCCTCGCATGGACA
ACTAGGGCGCTCGAGGTCGGCATGGACCAGACCGAAAAGAACCGCCAGTATTGCTCTGGCATGTATAGTCGAACG
ACATGGGGGGGCCCCGTCGACCCCTTCATCGAAATCAAGTTTCTCAACTCAACCATACCCGACGGTAGCGATCCG
ATAGCGAGCCTCATCATCTTCGAGTGGGCCGACAAGAATCTGGTCGGCGTTCCTGATCCAGACGTTCCCGGACTG
CAACTTGAGCTCTGCCATGATGAATCGGCGCAGCAAGGCCGCTGCAATGCCTCTTCCATCGGCGAGTTTATCATT
TCTCCGAACGCCACTAGAAAGTCCAACGCCATCATCCTCTCAAAAGCCGTTCACCTCAAGGAATCCGTACCCATC
CGCTACGCTATCAAGAAGACGGGTTACTATTGTGTCGTCACCGAGGTTTTCACCGCCGAGCAATACAGTCTCGTT
ACCGAGTTCCGCAATGCGTACGGAGAGCTTCCCGCCACTCAAATCCCGAAGCTACCCTTTTACGGCGGCATGACA
ATCCTCTATGCTCTCGTTTGCGTCTTTTGGGGCTTCCTCTACTACCAACATCGCCATGACATCTTGGCGGTTCAG
AACTACATCACCGCGATCCTTATCTTCTTGGTTATCGAGATGCTCATGACGTGGGGCTTCTATGACTACCAAAAT
CGCATTGGCAACAATGCCGTGTCCAAGGTCCTGCTCATCGTTGTCGGCATACTCAACGCCGCCCGCAACTCATTC
TCCTTCTTCCTGCTGCTCATCGTCTGCATGGGCTATGGCGTTGTCAAGCCGACACTCGGCCGCACCATGATACAC
GTCCGTTGGCTCGCAGCCGCCCACTTTGTCTTTGGGCTCGTCTACGCCATAACCAGTCTTTTGATTTCCCCGGAG
AGTGCAGGACCCTTTGTCCTCCTCATCGTACTGCCGTTGGCAGGGACGCTGACAGGCTTCTACGTTTGGACCCTC
AACTCGCTCAACTTTACTCTCAAGGACCTGAGGGAGCGCAAGCAGTATGCAAAGGAGGCCATGTATAAGAAGCTA
TGGTGGTCCATACTGGTCAGCATCCTCGTCATCTTTGCTTTCTTCTTCTTCAACAGCTTCACCTTTGCCTCGGTA
AATGATCCCGACTTTGTTCCGTTCCACTGGAAGACTAGGTGGTTTGTGCTGGACGGATGGCTCAACATCGTCTAC
TTTGGCGATGTGGTGTGGATCGCGTACGTCTGGCGTCCTACAGCCAACAACCGCCGGTTCGCCATGAGTGACGAG
ATTGCGCAAGACGACGATGGGAACTTTGAAATTGGCGACATTGGCATCCCGGAGGACTTTGAAGACGAGGAGGAG
GCTCACGGTGGCCACCATCAGAGGCACCTGCCACCTGTCACGGGCATCACCAGCGCCGGACCGGCAGCTGACAGC
CAGCAACGGGGCCAGAATCGGGGTCCCGGGCGGGAGTCTCTGGAAGCAGAGACCATCTTCGCCGTCGGTGAGGAT
GGCGATAAGCTTTCCGACGTCGGAAGCGAGGAGGAGGACGCCACGCTCGTCCAGGCCAAGTGA
Transcript >Ophcf2|05655
ATGTTTATTCTTGCAACCCCCATTTCCCTATCCTTTCAATCCTCACCAACTGGCGACGAAGCTTCTCTGCGCCTG
TCGAACGCGCAGAAGCGACTGCTCAGGATGAAGCTTCTTTCGGGCCTCTGCGTTCTGGGCCTCCTCGCATGGACA
ACTAGGGCGCTCGAGGTCGGCATGGACCAGACCGAAAAGAACCGCCAGTATTGCTCTGGCATGTATAGTCGAACG
ACATGGGGGGGCCCCGTCGACCCCTTCATCGAAATCAAGTTTCTCAACTCAACCATACCCGACGGTAGCGATCCG
ATAGCGAGCCTCATCATCTTCGAGTGGGCCGACAAGAATCTGGTCGGCGTTCCTGATCCAGACGTTCCCGGACTG
CAACTTGAGCTCTGCCATGATGAATCGGCGCAGCAAGGCCGCTGCAATGCCTCTTCCATCGGCGAGTTTATCATT
TCTCCGAACGCCACTAGAAAGTCCAACGCCATCATCCTCTCAAAAGCCGTTCACCTCAAGGAATCCGTACCCATC
CGCTACGCTATCAAGAAGACGGGTTACTATTGTGTCGTCACCGAGGTTTTCACCGCCGAGCAATACAGTCTCGTT
ACCGAGTTCCGCAATGCGTACGGAGAGCTTCCCGCCACTCAAATCCCGAAGCTACCCTTTTACGGCGGCATGACA
ATCCTCTATGCTCTCGTTTGCGTCTTTTGGGGCTTCCTCTACTACCAACATCGCCATGACATCTTGGCGGTTCAG
AACTACATCACCGCGATCCTTATCTTCTTGGTTATCGAGATGCTCATGACGTGGGGCTTCTATGACTACCAAAAT
CGCATTGGCAACAATGCCGTGTCCAAGGTCCTGCTCATCGTTGTCGGCATACTCAACGCCGCCCGCAACTCATTC
TCCTTCTTCCTGCTGCTCATCGTCTGCATGGGCTATGGCGTTGTCAAGCCGACACTCGGCCGCACCATGATACAC
GTCCGTTGGCTCGCAGCCGCCCACTTTGTCTTTGGGCTCGTCTACGCCATAACCAGTCTTTTGATTTCCCCGGAG
AGTGCAGGACCCTTTGTCCTCCTCATCGTACTGCCGTTGGCAGGGACGCTGACAGGCTTCTACGTTTGGACCCTC
AACTCGCTCAACTTTACTCTCAAGGACCTGAGGGAGCGCAAGCAGTATGCAAAGGAGGCCATGTATAAGAAGCTA
TGGTGGTCCATACTGGTCAGCATCCTCGTCATCTTTGCTTTCTTCTTCTTCAACAGCTTCACCTTTGCCTCGGTA
AATGATCCCGACTTTGTTCCGTTCCACTGGAAGACTAGGTGGTTTGTGCTGGACGGATGGCTCAACATCGTCTAC
TTTGGCGATGTGGTGTGGATCGCGTACGTCTGGCGTCCTACAGCCAACAACCGCCGGTTCGCCATGAGTGACGAG
ATTGCGCAAGACGACGATGGGAACTTTGAAATTGGCGACATTGGCATCCCGGAGGACTTTGAAGACGAGGAGGAG
GCTCACGGTGGCCACCATCAGAGGCACCTGCCACCTGTCACGGGCATCACCAGCGCCGGACCGGCAGCTGACAGC
CAGCAACGGGGCCAGAATCGGGGTCCCGGGCGGGAGTCTCTGGAAGCAGAGACCATCTTCGCCGTCGGTGAGGAT
GGCGATAAGCTTTCCGACGTCGGAAGCGAGGAGGAGGACGCCACGCTCGTCCAGGCCAAGTGA
Gene >Ophcf2|05655
ATGTTTATGTAAGTCGCCCGCTGTGTGTACAGAAAGCCACCTAATCTGGGTTCGCAGTCTTGCAACCCCCATTTC
CCTATCCTTTCAATCCTCACCAACTGGCGACGAAGCTTCTCTGCGCCTGTCGAACGCGCAGAAGTCAGTCGCAAA
GTCATTCACATTTCTATCGAAATGAAATAAACTTCTCCGCCGTGCTGCGCCGCAACGCCCATCTAGCCGCCCTCG
CCGGGCTCCTTCACCACTGAGTTGCAAGCCTCCGTCGCTGAAGCTCGTCTCGACTACTTTCGCGCTTAGGCGACT
GCTCAGGATGAAGCTTCTTTCGGGCCTCTGCGTTCTGGGCCTCCTCGCATGGACAACTAGGGCGCTCGAGGTCGG
CATGGTACGTGCGCGCCCTCTCTTGATGCTCGCGGGAGCTTTGAGTTGACTGGGCTCGTTCTCACAGGACCAGAC
CGAAAAGAACCGCCAGTATTGCTCTGGTTAGCAGCCATAATGACAATTTTCTGTGCGATTCTTGGGCTAATGGCC
TCAAGGCATGTATAGTCGAACGACATGGGGGGGCCCCGTCGACCCCTTCATCGAAATCAAGTTTCTCAACTCAAC
CATACCCGACGGTAGCGATCCGATAGCGAGCCTCATCATCTTCGAGTGGGCCGACAAGAATCTGGTCGGCGTTCC
TGATCCAGACGTTCCCGGACTGGTGAGGCGCCGTGCCCTTTAAGTGACAGAGGCACTACTCACACGCGCCGCCCT
AGCAACTTGAGCTCTGCCATGATGAATCGGCGCAGCAAGGCCGCTGCAATGCCTCTTCCATCGGCGAGTTTATCA
TTTCTCCGAACGCCACTAGAAAGTCCAACGCCATCATCCTCTCAAAAGCCGTTCACCTCAAGGAATCCGTACCCA
TCCGCTACGCTATCAAGAAGACGGGTTACTATTGTGTCGTCACCGAGGTTTTCACCGCCGAGCAATACAGTCTCG
TTACCGAGTTCCGCAATGCGTACGGAGAGCTTCCCGCCACTCAAATCCCGAAGCTACCCTTTTACGGCGGCATGA
CAATCCTCTATGCTCTCGTTTGCGTCTTTTGGGGCTTCCTCTACTACCAACATCGCCATGACATCTGTGAGCCGA
GTCTCTTCACGGAGCATACTCGTCAAGCTCGCTCGCTAATCCGGTGGCGGCAGTGGCGGTTCAGAACTACATCAC
CGCGATCCTTATCTTCTTGGTTATCGAGATGCTCATGACGTGGGGCTTCTATGGTCAGTCTTTACTCCATCAACC
GCCGCCGCTCGGCTTTGCGCTGAATCGACAGACTACCAAAATCGCATTGGCAACAATGCCGTGTCCAAGGTCCTG
CTCATCGTTGTCGGCATACTCAACGCCGCCCGCAACTCATTCTCCTTCTTCCTGCTGCTCATCGTCTGCATGGGC
TATGGCGTTGTCAAGCCGACACTCGGCCGCACCATGATACACGTCCGTTGGCTCGCAGCCGCCCACTTTGTCTTT
GGGCTCGTCTACGCCATAACCAGTCTTTTGATTTCCCCGGAGAGTGCAGGTGCGCTATCTTTCACCCTCGTTGCC
TTTGGCGTCATGCTTACTGGGCATTCAGGACCCTTTGTCCTCCTCATCGTACTGCCGTTGGCAGGGACGCTGACA
GGCTTCTACGTTTGGACCCTCAACTCGCTCAACTTTACTCTCAAGGACCTGAGGGAGCGCAAGCAGTATGCAAAG
GAGGCCATGTATAAGAAGCTATGGTGGTCCATACTGGTCAGCATCCTCGTCATCTTTGCTTTCTTCTTCTTCAAC
AGCTTCACCTTTGCCTCGGTAAATGATCCCGACTTTGTTCCGTTCCACTGGAAGACTAGGTGGTTTGTGCTGGAC
GGATGGCTCAACATCGTCTACTTTGGCGATGTGGTGTGGATCGCGTACGTCTGGCGTCCTACAGCCAACAACCGC
CGGTTCGCCATGAGTGACGAGATTGCGCAAGACGACGATGGGAACTTTGAAATTGGCGACATTGGCATCCCGGAG
GACTTTGAAGACGAGGAGGAGGCTCACGGTGGCCACCATCAGAGGCACCTGCCACCTGTCACGGGCATCACCAGC
GCCGGACCGGCAGCTGACAGCCAGCAACGGGGCCAGAATCGGGGTCCCGGGCGGGAGTCTCTGGAAGCAGAGACC
ATCTTCGCCGTCGGTGAGGATGGCGATAAGCTTTCCGACGTCGGAAGCGAGGAGGAGGACGCCACGCTCGTCCAG
GCCAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail