Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05650
Gene name
Locationscaffold_06:1889051..1892727
Strand-
Gene length (bp)3676
Transcript length (bp)3465
Coding sequence length (bp)3465
Protein length (aa) 1155

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00617 RasGEF RasGEF domain 8.2E-58 911 1092
PF00618 RasGEF_N RasGEF N-terminal motif 8.8E-29 743 845
PF00018 SH3_1 SH3 domain 3.4E-14 16 61
PF07653 SH3_2 Variant SH3 domain 3.1E-12 14 66
PF14604 SH3_9 Variant SH3 domain 1.2E-11 17 63

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0007264 small GTPase mediated signal transduction Yes
GO:0005085 guanyl-nucleotide exchange factor activity Yes
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0035556 intracellular signal transduction No
GO:0030695 GTPase regulator activity No
GO:0098772 molecular function regulator activity No
GO:0007165 signal transduction No
GO:0008150 biological_process No
GO:0050789 regulation of biological process No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0030234 enzyme regulator activity No
GO:0065007 biological regulation No
GO:0050794 regulation of cellular process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.7348 0.3485 0.1281 0.3314 0.025 0.0012 0.1264 0.3989 0.3466 0.0048

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5062
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5864
Ophiocordyceps australis map64 (Brazil) OphauB2|830
Ophiocordyceps camponoti-floridani Ophcf2|05650 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3054
Ophiocordyceps kimflemingae Ophio5|1946
Ophiocordyceps subramaniannii Hirsu2|2800

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05650
MAGMVGATQAGTMYVRALYDYEADDRTSLSFHQGDIIQVITQLESGWWDGFINGVRGWFPSNYCEIVTNPDEIPD
NDNGQADQIEVDAEEKPSHDQGSTQEDGPPADVAAGLRTESIVTGDKSRADFWIPQATPDGRLFYYNMMTGDHSM
ELPLESPGSPAEAGPHDRINVAMPERTRLPPELMARGLTQDEEEDSATSASEAEGESLLLAPREYTPRNRTSFVS
GLSPSTSMDSINGASASRANRIDAVANGKTAGPQPPPMTSATSFTSTTYHLPTTATVPRSFFDDGAASPLTWSSL
VFNMKHAIDRYREAITSNNRSEYVARAEDISDYLRLLLAAGSGTTDNHSGQPSVISTNKALYPHFRDMMSKFSKL
VISSHIAATDWPNVESVQKCLTEADGALAGVFSFVEVARQQRGEEIPRLFPGFVLGSNAGGSWQNNGLGPRDPIT
SNFLEDDDGATEPMAFLDGKFLERFDEQRRMLVSSIRELDKSLIAPEMVITPYRHEVIGNSVCSANGKVLDAFKP
WVAMVESIDMSALGAGIPITQLAKFNVSKQSLYDNIADLVLGCQAVTGPLADEWSEVRGEALENRLEYVRQCARA
LETNSSHISQSLQILLEQLQAQLQQQQQQQQQQHSRTDHRLRADSASRGPTQRGGSVSHERHHHRSESKSSRPRP
SHASSHASSQQHSDGEPVSGSVRKLKRLLGEDPAAPSALQANDDIPDFLRLDHEDDVSWDTKFAQPTVKGGTLLA
LVEQLTRHDKLDSNFNNTFLLTYRSFTSARELFELLVKRFGIQPPEGLNQSEYEIWRDRKQKLIRFRVVNILKSW
FDNFWMEEFNEESRQLMRDVYTFARDTVKSTDTPGSAPLMSVLDQRLSGKEAAARRMIQTLNQSTPAPIVPKNMR
KLKFLDIDVTEFARQLTIIESRLYGKIKAAECLNKTWQRKVPEGDPDPAPNVKALILHSNQMTNWVAEMILAQMD
VKKRVVVIKHFVAVADKCRGLNNFSTLTSVISALGTAPIARLKRTWDQVPQRTQAVLETMRQLMASTKNFGEYRE
ALHAANPPCIPFFGVYLTDLTFIEDGIPSIIKKTNLINFAKRAKTAEVIRDIQQYQNVGYSLQPVPELQDYILSN
MQAAGDVHEMYDKSLQIEPREREDEKIVR*
Coding >Ophcf2|05650
ATGGCCGGCATGGTGGGCGCGACGCAAGCCGGCACCATGTACGTCCGCGCCTTGTACGATTACGAGGCGGACGAC
CGGACCAGTCTCAGCTTCCACCAAGGAGATATCATACAGGTCATCACCCAACTCGAGAGCGGCTGGTGGGACGGA
TTCATAAACGGCGTTCGTGGCTGGTTCCCGAGCAATTATTGCGAAATCGTCACCAACCCCGACGAGATTCCCGAC
AATGACAATGGTCAAGCCGATCAGATCGAGGTCGACGCTGAAGAGAAACCATCACACGATCAAGGCTCCACCCAG
GAAGATGGGCCTCCAGCGGATGTGGCCGCCGGCTTGCGAACCGAGAGTATCGTCACCGGAGACAAGTCGAGGGCT
GATTTCTGGATTCCCCAGGCAACCCCAGACGGTCGCTTGTTCTACTATAACATGATGACGGGCGATCACAGCATG
GAGCTGCCGCTGGAGTCGCCAGGTTCTCCCGCCGAGGCGGGGCCCCACGACCGCATCAACGTCGCAATGCCCGAG
AGAACCCGGCTCCCACCCGAGCTCATGGCCAGAGGCCTGACCCAGGACGAGGAGGAGGACTCTGCTACTTCAGCC
TCCGAGGCTGAGGGAGAGTCACTCCTTCTCGCACCACGAGAATATACGCCCCGAAACCGAACCTCATTCGTTAGC
GGCCTGTCTCCGTCAACCTCGATGGACTCGATAAACGGTGCCTCTGCTAGTCGGGCGAATAGAATTGATGCAGTG
GCCAACGGCAAGACGGCAGGCCCCCAGCCGCCCCCCATGACATCGGCTACATCCTTTACGAGCACCACTTATCAC
CTCCCGACCACGGCTACTGTGCCTCGGTCTTTCTTCGATGACGGGGCCGCCTCCCCCCTCACCTGGAGCTCACTA
GTGTTCAATATGAAGCACGCAATCGACCGTTATCGCGAAGCCATCACAAGCAATAATCGCTCGGAATACGTCGCG
AGAGCGGAGGATATATCTGACTATCTACGCCTACTTCTGGCCGCCGGTTCCGGCACCACGGATAACCACTCTGGC
CAACCGTCAGTAATCTCGACAAACAAGGCCTTGTACCCTCATTTCCGAGACATGATGTCCAAATTCTCCAAGCTT
GTGATATCTTCCCACATCGCCGCAACTGATTGGCCCAATGTTGAATCTGTACAAAAGTGCTTAACAGAGGCAGAC
GGTGCTCTGGCCGGCGTCTTCAGTTTTGTCGAAGTAGCCAGACAGCAGCGGGGAGAAGAGATCCCTCGCCTATTC
CCTGGATTCGTTCTCGGCAGCAACGCCGGTGGCAGCTGGCAGAACAATGGTCTTGGACCACGGGACCCAATAACC
TCAAACTTCCTTGAGGATGACGACGGCGCGACGGAGCCCATGGCTTTCCTCGATGGCAAGTTTCTAGAGAGATTC
GACGAGCAAAGACGGATGCTGGTCTCGAGCATTCGAGAACTCGACAAAAGTCTGATTGCCCCGGAAATGGTCATC
ACTCCCTACCGTCATGAGGTCATTGGCAATAGCGTCTGCTCCGCCAACGGCAAGGTTCTGGACGCCTTTAAGCCA
TGGGTAGCCATGGTTGAATCTATCGACATGTCAGCCCTTGGTGCTGGCATCCCAATAACGCAATTGGCGAAATTC
AACGTCAGCAAGCAAAGCCTTTATGACAATATTGCAGACCTAGTCCTGGGATGTCAGGCAGTTACAGGCCCTCTG
GCGGACGAGTGGAGCGAAGTTCGAGGCGAAGCGCTGGAGAACCGACTAGAGTACGTTCGACAGTGTGCCAGAGCC
TTGGAAACCAACTCGTCGCACATCAGCCAGTCCCTGCAAATACTCCTGGAGCAATTGCAAGCGCAATTGCAGCAG
CAGCAGCAGCAGCAGCAGCAGCAGCATTCACGAACCGACCATCGACTTCGAGCGGATTCCGCCTCACGAGGTCCA
ACGCAACGGGGCGGCAGCGTGTCACATGAGCGACACCATCACCGCTCAGAATCCAAATCCAGCAGGCCGCGGCCA
TCTCACGCCTCATCGCATGCCTCATCTCAGCAACACAGCGATGGGGAGCCGGTATCAGGAAGTGTCAGGAAGCTT
AAGAGGCTACTCGGCGAAGATCCGGCAGCTCCATCCGCCCTGCAAGCCAACGATGACATCCCCGATTTCTTGAGA
CTCGACCACGAAGACGATGTCTCTTGGGATACCAAGTTTGCCCAGCCCACGGTGAAGGGTGGCACTCTCCTCGCT
CTGGTGGAACAACTCACACGTCATGACAAGCTTGACTCTAACTTCAATAACACCTTTCTCTTGACTTACAGGTCA
TTCACGTCGGCGCGTGAGCTATTTGAACTTCTCGTCAAGCGATTCGGCATCCAACCGCCCGAGGGCCTCAATCAG
TCAGAATACGAGATCTGGCGAGATCGCAAGCAGAAGTTGATTCGTTTCCGCGTAGTCAACATCCTCAAGAGCTGG
TTTGACAACTTCTGGATGGAGGAGTTCAACGAGGAATCAAGGCAGTTGATGCGTGATGTCTATACCTTTGCAAGA
GACACCGTCAAGTCGACAGACACTCCCGGATCCGCCCCCTTGATGTCCGTTCTCGACCAGAGGCTGAGCGGCAAA
GAAGCAGCGGCTCGACGGATGATTCAGACTCTGAACCAGAGCACACCAGCGCCCATTGTGCCCAAAAACATGAGA
AAACTCAAGTTTCTGGACATAGACGTGACCGAGTTCGCTCGTCAGCTAACTATCATCGAGTCTCGGCTATACGGG
AAAATCAAGGCGGCTGAGTGTCTGAATAAGACGTGGCAGAGAAAGGTGCCCGAGGGCGACCCGGACCCTGCCCCA
AACGTCAAGGCCCTGATTCTTCACTCGAATCAGATGACGAATTGGGTGGCGGAGATGATTCTCGCACAGATGGAC
GTCAAGAAGCGGGTAGTGGTGATCAAGCACTTTGTCGCCGTTGCCGATAAATGCCGGGGCCTCAATAATTTCTCA
ACCCTGACGTCGGTAATATCGGCTCTCGGGACGGCACCCATCGCTCGGCTCAAGAGAACATGGGACCAAGTGCCC
CAGCGCACGCAGGCAGTACTTGAGACAATGCGGCAATTGATGGCCAGCACCAAAAACTTTGGCGAATACCGCGAG
GCTCTGCATGCTGCGAACCCGCCTTGCATCCCCTTCTTCGGCGTCTACCTGACCGATCTCACTTTCATCGAGGAC
GGCATTCCGTCCATCATCAAGAAGACGAATCTGATCAACTTTGCGAAGCGGGCGAAAACGGCCGAAGTCATCCGC
GACATCCAACAGTACCAGAACGTGGGCTACTCGCTGCAGCCGGTTCCCGAGCTGCAGGATTACATCTTGAGCAAC
ATGCAGGCCGCAGGAGACGTGCACGAGATGTACGACAAGAGCTTGCAGATCGAGCCGCGCGAGCGCGAGGACGAG
AAGATTGTGAGGTAG
Transcript >Ophcf2|05650
ATGGCCGGCATGGTGGGCGCGACGCAAGCCGGCACCATGTACGTCCGCGCCTTGTACGATTACGAGGCGGACGAC
CGGACCAGTCTCAGCTTCCACCAAGGAGATATCATACAGGTCATCACCCAACTCGAGAGCGGCTGGTGGGACGGA
TTCATAAACGGCGTTCGTGGCTGGTTCCCGAGCAATTATTGCGAAATCGTCACCAACCCCGACGAGATTCCCGAC
AATGACAATGGTCAAGCCGATCAGATCGAGGTCGACGCTGAAGAGAAACCATCACACGATCAAGGCTCCACCCAG
GAAGATGGGCCTCCAGCGGATGTGGCCGCCGGCTTGCGAACCGAGAGTATCGTCACCGGAGACAAGTCGAGGGCT
GATTTCTGGATTCCCCAGGCAACCCCAGACGGTCGCTTGTTCTACTATAACATGATGACGGGCGATCACAGCATG
GAGCTGCCGCTGGAGTCGCCAGGTTCTCCCGCCGAGGCGGGGCCCCACGACCGCATCAACGTCGCAATGCCCGAG
AGAACCCGGCTCCCACCCGAGCTCATGGCCAGAGGCCTGACCCAGGACGAGGAGGAGGACTCTGCTACTTCAGCC
TCCGAGGCTGAGGGAGAGTCACTCCTTCTCGCACCACGAGAATATACGCCCCGAAACCGAACCTCATTCGTTAGC
GGCCTGTCTCCGTCAACCTCGATGGACTCGATAAACGGTGCCTCTGCTAGTCGGGCGAATAGAATTGATGCAGTG
GCCAACGGCAAGACGGCAGGCCCCCAGCCGCCCCCCATGACATCGGCTACATCCTTTACGAGCACCACTTATCAC
CTCCCGACCACGGCTACTGTGCCTCGGTCTTTCTTCGATGACGGGGCCGCCTCCCCCCTCACCTGGAGCTCACTA
GTGTTCAATATGAAGCACGCAATCGACCGTTATCGCGAAGCCATCACAAGCAATAATCGCTCGGAATACGTCGCG
AGAGCGGAGGATATATCTGACTATCTACGCCTACTTCTGGCCGCCGGTTCCGGCACCACGGATAACCACTCTGGC
CAACCGTCAGTAATCTCGACAAACAAGGCCTTGTACCCTCATTTCCGAGACATGATGTCCAAATTCTCCAAGCTT
GTGATATCTTCCCACATCGCCGCAACTGATTGGCCCAATGTTGAATCTGTACAAAAGTGCTTAACAGAGGCAGAC
GGTGCTCTGGCCGGCGTCTTCAGTTTTGTCGAAGTAGCCAGACAGCAGCGGGGAGAAGAGATCCCTCGCCTATTC
CCTGGATTCGTTCTCGGCAGCAACGCCGGTGGCAGCTGGCAGAACAATGGTCTTGGACCACGGGACCCAATAACC
TCAAACTTCCTTGAGGATGACGACGGCGCGACGGAGCCCATGGCTTTCCTCGATGGCAAGTTTCTAGAGAGATTC
GACGAGCAAAGACGGATGCTGGTCTCGAGCATTCGAGAACTCGACAAAAGTCTGATTGCCCCGGAAATGGTCATC
ACTCCCTACCGTCATGAGGTCATTGGCAATAGCGTCTGCTCCGCCAACGGCAAGGTTCTGGACGCCTTTAAGCCA
TGGGTAGCCATGGTTGAATCTATCGACATGTCAGCCCTTGGTGCTGGCATCCCAATAACGCAATTGGCGAAATTC
AACGTCAGCAAGCAAAGCCTTTATGACAATATTGCAGACCTAGTCCTGGGATGTCAGGCAGTTACAGGCCCTCTG
GCGGACGAGTGGAGCGAAGTTCGAGGCGAAGCGCTGGAGAACCGACTAGAGTACGTTCGACAGTGTGCCAGAGCC
TTGGAAACCAACTCGTCGCACATCAGCCAGTCCCTGCAAATACTCCTGGAGCAATTGCAAGCGCAATTGCAGCAG
CAGCAGCAGCAGCAGCAGCAGCAGCATTCACGAACCGACCATCGACTTCGAGCGGATTCCGCCTCACGAGGTCCA
ACGCAACGGGGCGGCAGCGTGTCACATGAGCGACACCATCACCGCTCAGAATCCAAATCCAGCAGGCCGCGGCCA
TCTCACGCCTCATCGCATGCCTCATCTCAGCAACACAGCGATGGGGAGCCGGTATCAGGAAGTGTCAGGAAGCTT
AAGAGGCTACTCGGCGAAGATCCGGCAGCTCCATCCGCCCTGCAAGCCAACGATGACATCCCCGATTTCTTGAGA
CTCGACCACGAAGACGATGTCTCTTGGGATACCAAGTTTGCCCAGCCCACGGTGAAGGGTGGCACTCTCCTCGCT
CTGGTGGAACAACTCACACGTCATGACAAGCTTGACTCTAACTTCAATAACACCTTTCTCTTGACTTACAGGTCA
TTCACGTCGGCGCGTGAGCTATTTGAACTTCTCGTCAAGCGATTCGGCATCCAACCGCCCGAGGGCCTCAATCAG
TCAGAATACGAGATCTGGCGAGATCGCAAGCAGAAGTTGATTCGTTTCCGCGTAGTCAACATCCTCAAGAGCTGG
TTTGACAACTTCTGGATGGAGGAGTTCAACGAGGAATCAAGGCAGTTGATGCGTGATGTCTATACCTTTGCAAGA
GACACCGTCAAGTCGACAGACACTCCCGGATCCGCCCCCTTGATGTCCGTTCTCGACCAGAGGCTGAGCGGCAAA
GAAGCAGCGGCTCGACGGATGATTCAGACTCTGAACCAGAGCACACCAGCGCCCATTGTGCCCAAAAACATGAGA
AAACTCAAGTTTCTGGACATAGACGTGACCGAGTTCGCTCGTCAGCTAACTATCATCGAGTCTCGGCTATACGGG
AAAATCAAGGCGGCTGAGTGTCTGAATAAGACGTGGCAGAGAAAGGTGCCCGAGGGCGACCCGGACCCTGCCCCA
AACGTCAAGGCCCTGATTCTTCACTCGAATCAGATGACGAATTGGGTGGCGGAGATGATTCTCGCACAGATGGAC
GTCAAGAAGCGGGTAGTGGTGATCAAGCACTTTGTCGCCGTTGCCGATAAATGCCGGGGCCTCAATAATTTCTCA
ACCCTGACGTCGGTAATATCGGCTCTCGGGACGGCACCCATCGCTCGGCTCAAGAGAACATGGGACCAAGTGCCC
CAGCGCACGCAGGCAGTACTTGAGACAATGCGGCAATTGATGGCCAGCACCAAAAACTTTGGCGAATACCGCGAG
GCTCTGCATGCTGCGAACCCGCCTTGCATCCCCTTCTTCGGCGTCTACCTGACCGATCTCACTTTCATCGAGGAC
GGCATTCCGTCCATCATCAAGAAGACGAATCTGATCAACTTTGCGAAGCGGGCGAAAACGGCCGAAGTCATCCGC
GACATCCAACAGTACCAGAACGTGGGCTACTCGCTGCAGCCGGTTCCCGAGCTGCAGGATTACATCTTGAGCAAC
ATGCAGGCCGCAGGAGACGTGCACGAGATGTACGACAAGAGCTTGCAGATCGAGCCGCGCGAGCGCGAGGACGAG
AAGATTGTGAGGTAG
Gene >Ophcf2|05650
ATGGCCGGCATGGTGGGCGCGACGCAAGCCGGCACCATGTACGTCCGCGCCTTGTACGATTACGAGGCGGACGAC
CGGACCAGTCTCAGCTTCCACCAAGGAGATATCATACAGGTCATCACCCAACTCGAGAGCGGCTGGTGGGACGGA
TTCATAAACGGCGTTCGTGGCTGGTTCCCGAGCAATTATTGCGAAATCGTCACCAACCCCGACGAGATTCCCGAC
AATGACAATGGTCAAGCCGATCAGATCGAGGTCGACGCTGAAGAGAAACCATCACACGATCAAGGCTCCACCCAG
GAAGATGGGCCTCCAGCGGATGTGGCCGCCGGCTTGCGAACCGAGAGTATCGTCACCGGAGACAAGTCGAGGGCT
GATTTCTGGATTCCCCAGGCAACCCCAGACGGTCGCTTGTTCTACTATAACATGATGACGGGCGATCACAGCATG
GAGCTGCCGCTGGAGTCGCCAGGTTCTCCCGCCGAGGCGGGGCCCCACGACCGCATCAACGTCGCAATGCCCGAG
AGAACCCGGCTCCCACCCGAGCTCATGGCCAGAGGCCTGACCCAGGACGAGGAGGAGGACTCTGCTACTTCAGCC
TCCGAGGCTGAGGGAGAGTCACTCCTTCTCGCACCACGAGAATATACGGTTGGGACCCTAATTCTTAGAGTCGTC
ATCTTAATTGCTGGTAGCGTGGCTGACCGTCTTGACTTTAAAAGCCCCGAAACCGAACCTCATTCGTTAGCGGCC
TGTCTCCGTCAACCTCGATGGACTCGATAAACGGTGCCTCTGCTAGTCGGGCGAATAGAATTGATGCAGTGGCCA
ACGGCAAGACGGCAGGCCCCCAGCCGCCCCCCATGACATCGGCTACATCCTTTACGAGCACCACTTATCACCTCC
CGACCACGGCTACTGTGCCTCGGTCTTTCTTCGATGACGGGGCCGCCTCCCCCCTCACCTGGAGCTCACTAGTGT
TCAATATGAAGCACGCAATCGACCGTTATCGCGAAGCCATCACAAGCAATAATCGCTCGGAATACGTCGCGAGAG
CGGAGGATATATCTGACTATCTACGCCTACTTCTGGCCGCCGGTTCCGGCACCACGGATAACCACTCTGGCCAAC
CGTCAGTAATCTCGACAAACAAGGCCTTGTACCCTCATTTCCGAGACATGATGTCCAAATTCTCCAAGCTTGTGA
TATCTTCCCACATCGCCGCAACTGATTGGCCCAATGTTGAATCTGTACAAAAGTGCTTAACAGAGGCAGACGGTG
CTCTGGCCGGCGTCTTCAGTTTTGTCGAAGTAGCCAGACAGCAGCGGGGAGAAGAGATCCCTCGCCTATTCCCTG
GATTCGTTCTCGGCAGCAACGCCGGTGGCAGCTGGCAGAACAATGGTCTTGGACCACGGGACCCAATAACCTCAA
ACTTCCTTGAGGATGACGACGGCGCGACGGAGCCCATGGCTTTCCTCGATGGCAAGTTTCTAGAGAGATTCGACG
AGCAAAGACGGATGCTGGTCTCGAGCATTCGAGAACTCGACAAAAGTCTGATTGCCCCGGAAATGGTCATCACTC
CCTACCGTCATGAGGTCATTGGCAATAGCGTCTGCTCCGCCAACGGCAAGGTTCTGGACGCCTTTAAGCCATGGG
TAGCCATGGTTGAATCTATCGACATGTCAGCCCTTGGTGCTGGCATCCCAATAACGCAATTGGCGAAATTCAACG
TCAGCAAGCAAAGCCTTTATGACAATATTGCAGACCTAGTCCTGGGATGTCAGGCAGTTACAGGCCCTCTGGCGG
ACGAGTGGAGCGAAGTTCGAGGCGAAGCGCTGGAGAACCGACTAGAGTACGTTCGACAGTGTGCCAGAGCCTTGG
AAACCAACTCGTCGCACATCAGCCAGTCCCTGCAAATACTCCTGGAGCAATTGCAAGCGCAATTGCAGCAGCAGC
AGCAGCAGCAGCAGCAGCAGCATTCACGAACCGACCATCGACTTCGAGCGGATTCCGCCTCACGAGGTCCAACGC
AACGGGGCGGCAGCGTGTCACATGAGCGACACCATCACCGCTCAGAATCCAAATCCAGCAGGCCGCGGCCATCTC
ACGCCTCATCGCATGCCTCATCTCAGCAACACAGCGATGGGGAGCCGGTATCAGGAAGTGTCAGGAAGCTTAAGA
GGCTACTCGGCGAAGATCCGGCAGCTCCATCCGCCCTGCAAGCCAACGATGACATCCCCGATTTCTTGAGACTCG
ACCACGAAGACGATGTCTCTTGGGATACCAAGTTTGCCCAGCCCACGGTGAAGGGTGGCACTCTCCTCGCTCTGG
TGGAACAACTCACACGTCATGACAAGCTTGACTCTAACTTCAATAACACCTTTCTCTTGACTTACAGGTCATTCA
CGTCGGCGCGTGAGCTATTTGAACTTCTCGTCAAGCGATTCGGCATCCAACCGCCCGAGGGCCTCAATCAGTCAG
AATACGAGATCTGGCGAGATCGCAAGCAGAAGTTGATTCGTTTCCGCGTAGTCAACATCCTCAAGAGCTGGTTTG
ACAACTTCTGGATGGAGGAGTTCAACGAGGAATCAAGGCAGTTGATGCGTGATGTCTATACCTTTGCAAGAGACA
CCGTCAAGTCGACAGACACTCCCGGATCCGCCCCCTTGATGTCCGTTCTCGACCAGAGGCTGAGCGGCAAAGAAG
CAGCGGCTCGACGGATGATTCAGACTCTGAACCAGAGCACACCAGCGCCCATTGTGCCCAAAAACATGAGAAAAC
TCAAGTTTCTGGACATAGACGTGACCGAGTTCGCTCGTCAGCTAACTATCATCGAGTCTCGGCTATACGGGAAAA
TCAAGGCGGCTGAGTGTCTGAATAAGACGTGGCAGAGAAAGGTGCCCGAGGGCGACCCGGACCCTGCCCCAAACG
TCAAGGCCCTGATTCTTCACTCGAATCAGATGACGAATTGGGTGGCGGAGATGATTCTCGCACAGATGGACGTCA
AGAAGCGGGTAGTGGTGATCAAGCACTTTGTCGCCGTTGCCGATGTCAGTCTTAACCCTTATCCTTTATTGCCCG
GGCATCGCGTTGTCAAGTTCCGGTCTCAGTGCAGTCTCCGCTTACTGACAGCTACAGAAATGCCGGGGCCTCAAT
AATTTCTCAACCCTGACGTCGGTAATATCGGCTCTCGGGACGGCACCCATCGCTCGGCTCAAGAGAACATGGGAC
CAAGTGCCCCAGCGCACGCAGGCAGTACTTGAGACAATGCGGCAATTGATGGCCAGCACCAAAAACTTTGGCGAA
TACCGCGAGGCTCTGCATGCTGCGAACCCGCCTTGCATCCCCTTCTTCGGTAAAGAAGCTACGGGTGTGTGTCAT
AGTCATCTTTGACTGATCAGTTACAGGCGTCTACCTGACCGATCTCACTTTCATCGAGGACGGCATTCCGTCCAT
CATCAAGAAGACGAATCTGATCAACTTTGCGAAGCGGGCGAAAACGGCCGAAGTCATCCGCGACATCCAACAGTA
CCAGAACGTGGGCTACTCGCTGCAGCCGGTTCCCGAGCTGCAGGATTACATCTTGAGCAACATGCAGGCCGCAGG
AGACGTGCACGAGATGTACGACAAGAGCTTGCAGATCGAGCCGCGCGAGCGCGAGGACGAGAAGATTGTGAGGTA
G

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail