Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05641
Gene name
Locationscaffold_06:1530625..1532691
Strand+
Gene length (bp)2066
Transcript length (bp)1722
Coding sequence length (bp)1722
Protein length (aa) 574

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04928 PAP_central Poly(A) polymerase central domain 6.5E-109 8 356
PF04926 PAP_RNA-bind Poly(A) polymerase predicted RNA binding domain 1.0E-63 358 539
PF01909 NTP_transf_2 Nucleotidyltransferase domain 2.5E-08 82 166

GO

GO Term Description Terminal node
GO:0016779 nucleotidyltransferase activity Yes
GO:0043631 RNA polyadenylation Yes
GO:0003723 RNA binding Yes
GO:0004652 polynucleotide adenylyltransferase activity Yes
GO:0016740 transferase activity No
GO:0097159 organic cyclic compound binding No
GO:0044237 cellular metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009987 cellular process No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0070566 adenylyltransferase activity No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0043170 macromolecule metabolic process No
GO:0003824 catalytic activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.4717 0.7777 0.1706 0.0525 0.1727 0.0075 0.0276 0.0203 0.0349 0.0009

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5352
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5197
Ophiocordyceps australis map64 (Brazil) OphauB2|4597
Ophiocordyceps camponoti-floridani Ophcf2|05641 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3045
Ophiocordyceps kimflemingae Ophio5|1936
Ophiocordyceps subramaniannii Hirsu2|5222

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05641
MPGEQVFGVTPPISVTLPTDLEKRSSDALIEELRRQKTFESPSDTQKRYKVLESLQFICDEFVKRVARDKEPKND
MLIKNARGKVFTYGSFRLGVFGPGSDIDTLIVAPKYVTRDDYFKLFPDLLVEMAPKGAITGLTVVTEAFVPIIKF
EYSGISIDLIFSRIVQKQLSASFQDLKDSALLRGLDEAELRSLNGTRVTDEILNLVPEQSTFKLALRAIKLWAQR
RAVYANIMGFPGGVAWAMLVARVCQLYPKAATSVIVNKFFLVIGQWRWPHPVLLKPIESGPLPVRVWNPKIYKGD
TFHLMPVITPAYPSMCATFNITRSSMAVINRELQRGLKLSENIMVGKSPWSDLFVKHTFFTSDYRYYISVISAAK
DKEAHKIWSGYVESKVRMLVQKLELHPAIALAHAFNKGYDRRHRCKDDQQIAQVQEGCLDYMISADDVTKEADSG
RDVAKTDDDSEPASYTDVFTTTHYIGIQLVEKAKSLDLSFQVDEFKSLCTQWKKFQDDLRTLVSIGVQHVRNVNL
PDDVFEAGEKKPQKKGVKRPPMAEKRGPSEDNAPPPAKRHQTSVVAAG*
Coding >Ophcf2|05641
ATGCCTGGAGAGCAGGTGTTCGGCGTCACGCCACCCATTTCTGTCACACTCCCTACAGACTTGGAGAAGCGATCC
AGCGATGCTCTGATCGAGGAGCTGCGTCGACAGAAGACGTTCGAGAGCCCGTCCGATACTCAGAAGAGATACAAG
GTCCTCGAATCTTTGCAGTTCATTTGCGACGAATTTGTCAAACGGGTCGCGAGGGACAAAGAGCCCAAGAACGAC
ATGTTGATTAAGAACGCTCGTGGCAAGGTATTCACCTATGGGAGCTTCAGACTGGGAGTCTTCGGCCCCGGCTCT
GACATCGACACGCTCATCGTCGCTCCCAAATATGTAACACGAGACGACTACTTCAAGCTATTTCCGGACTTGCTG
GTCGAAATGGCACCCAAGGGCGCCATCACAGGTCTAACTGTCGTCACCGAAGCCTTCGTACCCATCATCAAATTT
GAATATTCCGGAATAAGTATCGATTTGATTTTTTCCCGCATTGTTCAGAAGCAGCTCTCAGCTAGCTTCCAGGAT
CTGAAGGACTCGGCCCTTCTCCGCGGCTTGGACGAGGCTGAGCTACGGTCTCTCAACGGCACTCGTGTGACAGAC
GAGATACTGAATCTTGTGCCCGAGCAAAGTACTTTCAAGTTAGCCTTGCGCGCTATCAAGCTATGGGCTCAGCGC
CGTGCCGTTTATGCCAACATCATGGGTTTCCCCGGCGGCGTGGCCTGGGCTATGCTGGTCGCTCGAGTGTGCCAG
TTGTACCCGAAGGCAGCCACGTCCGTGATTGTCAACAAATTTTTCCTCGTCATTGGGCAGTGGCGGTGGCCACAT
CCTGTTCTTCTCAAACCCATTGAGAGTGGTCCCCTTCCAGTCCGCGTCTGGAATCCGAAGATCTACAAAGGTGAC
ACTTTCCATCTCATGCCGGTCATCACTCCAGCATATCCGTCAATGTGTGCCACATTCAATATTACTCGCTCTTCC
ATGGCGGTCATCAACAGAGAGCTTCAGCGCGGCTTAAAACTGTCGGAAAACATCATGGTCGGCAAGAGTCCATGG
AGCGATCTTTTCGTCAAGCACACATTCTTCACGTCGGATTATAGATACTACATATCCGTCATTTCAGCTGCCAAG
GACAAAGAAGCTCACAAAATTTGGTCGGGCTACGTCGAGTCAAAAGTCCGCATGCTAGTACAGAAACTCGAGTTG
CACCCAGCCATAGCGTTAGCACACGCCTTCAATAAAGGCTACGACAGGCGTCATCGCTGTAAAGACGATCAGCAG
ATTGCTCAAGTGCAGGAAGGCTGTCTCGACTACATGATTAGCGCCGATGACGTGACCAAGGAAGCGGACAGCGGC
CGAGATGTTGCGAAGACCGATGACGATTCGGAGCCTGCCTCCTATACCGATGTATTCACAACTACTCATTACATC
GGAATTCAACTTGTAGAAAAGGCAAAGTCACTGGATTTGTCCTTCCAGGTGGACGAGTTTAAATCACTCTGCACT
CAATGGAAGAAATTTCAAGACGATCTTCGTACTTTGGTCTCCATCGGCGTTCAGCATGTGCGAAATGTCAATCTT
CCCGACGACGTCTTCGAGGCGGGTGAAAAGAAGCCACAGAAAAAGGGTGTCAAGCGGCCACCGATGGCAGAAAAG
CGTGGCCCGTCAGAGGACAACGCTCCGCCGCCAGCGAAGAGACACCAAACCTCCGTGGTTGCCGCCGGCTGA
Transcript >Ophcf2|05641
ATGCCTGGAGAGCAGGTGTTCGGCGTCACGCCACCCATTTCTGTCACACTCCCTACAGACTTGGAGAAGCGATCC
AGCGATGCTCTGATCGAGGAGCTGCGTCGACAGAAGACGTTCGAGAGCCCGTCCGATACTCAGAAGAGATACAAG
GTCCTCGAATCTTTGCAGTTCATTTGCGACGAATTTGTCAAACGGGTCGCGAGGGACAAAGAGCCCAAGAACGAC
ATGTTGATTAAGAACGCTCGTGGCAAGGTATTCACCTATGGGAGCTTCAGACTGGGAGTCTTCGGCCCCGGCTCT
GACATCGACACGCTCATCGTCGCTCCCAAATATGTAACACGAGACGACTACTTCAAGCTATTTCCGGACTTGCTG
GTCGAAATGGCACCCAAGGGCGCCATCACAGGTCTAACTGTCGTCACCGAAGCCTTCGTACCCATCATCAAATTT
GAATATTCCGGAATAAGTATCGATTTGATTTTTTCCCGCATTGTTCAGAAGCAGCTCTCAGCTAGCTTCCAGGAT
CTGAAGGACTCGGCCCTTCTCCGCGGCTTGGACGAGGCTGAGCTACGGTCTCTCAACGGCACTCGTGTGACAGAC
GAGATACTGAATCTTGTGCCCGAGCAAAGTACTTTCAAGTTAGCCTTGCGCGCTATCAAGCTATGGGCTCAGCGC
CGTGCCGTTTATGCCAACATCATGGGTTTCCCCGGCGGCGTGGCCTGGGCTATGCTGGTCGCTCGAGTGTGCCAG
TTGTACCCGAAGGCAGCCACGTCCGTGATTGTCAACAAATTTTTCCTCGTCATTGGGCAGTGGCGGTGGCCACAT
CCTGTTCTTCTCAAACCCATTGAGAGTGGTCCCCTTCCAGTCCGCGTCTGGAATCCGAAGATCTACAAAGGTGAC
ACTTTCCATCTCATGCCGGTCATCACTCCAGCATATCCGTCAATGTGTGCCACATTCAATATTACTCGCTCTTCC
ATGGCGGTCATCAACAGAGAGCTTCAGCGCGGCTTAAAACTGTCGGAAAACATCATGGTCGGCAAGAGTCCATGG
AGCGATCTTTTCGTCAAGCACACATTCTTCACGTCGGATTATAGATACTACATATCCGTCATTTCAGCTGCCAAG
GACAAAGAAGCTCACAAAATTTGGTCGGGCTACGTCGAGTCAAAAGTCCGCATGCTAGTACAGAAACTCGAGTTG
CACCCAGCCATAGCGTTAGCACACGCCTTCAATAAAGGCTACGACAGGCGTCATCGCTGTAAAGACGATCAGCAG
ATTGCTCAAGTGCAGGAAGGCTGTCTCGACTACATGATTAGCGCCGATGACGTGACCAAGGAAGCGGACAGCGGC
CGAGATGTTGCGAAGACCGATGACGATTCGGAGCCTGCCTCCTATACCGATGTATTCACAACTACTCATTACATC
GGAATTCAACTTGTAGAAAAGGCAAAGTCACTGGATTTGTCCTTCCAGGTGGACGAGTTTAAATCACTCTGCACT
CAATGGAAGAAATTTCAAGACGATCTTCGTACTTTGGTCTCCATCGGCGTTCAGCATGTGCGAAATGTCAATCTT
CCCGACGACGTCTTCGAGGCGGGTGAAAAGAAGCCACAGAAAAAGGGTGTCAAGCGGCCACCGATGGCAGAAAAG
CGTGGCCCGTCAGAGGACAACGCTCCGCCGCCAGCGAAGAGACACCAAACCTCCGTGGTTGCCGCCGGCTGA
Gene >Ophcf2|05641
ATGCCTGGAGAGCAGGTGTTCGGCGTCACGCCACCCATTTCTGTCACACTCCCTACAGACTTGGAGAAGCGATCC
AGCGATGCTCTGATCGAGGAGCTGCGTCGACAGAAGACGTTCGAGAGCCCGTCCGATACTCAGAAGAGGTCTCTA
TAAGGATTTTTTGGGCCGTATATTGAAGCCGTATTACACTTGCCCTAACAAGCGTCTCACAGATACAAGGTCCTC
GAATCTTTGCAGTTCATTTGCGACGAATTTGTCAAACGGGTCGCGAGGGACAAAGAGCCCAAGAACGACATGTTG
ATTAAGAACGCTCGTGGCAAGGTATTCACCTATGGGAGCTTCAGACTGGGAGTCTTCGGCCCCGGCTCTGACATC
GACACGCTCATCGTCGCTCCCAAATATGTAACACGAGACGACTACTTCAAGCTATTTCCGGACTTGCTGGTCGAA
ATGGCACCCAAGGGCGCCATCACAGGTCTAACTGTCGTCACCGAAGCCTTCGTACCCATCATCAAATTTGAATAT
TCCGGAATAAGTATCGATTTGATTTTTTCCCGCATTGTTCAGAAGCAGCTCTCAGCTAGCTTCCAGGATCTGAAG
GACTCGGCCCTTCTCCGCGGCTTGGACGAGGCTGAGCTACGGTCTCTCAACGGCACTCGTGTGACAGACGAGATA
CTGAATCTTGTGCCCGAGCAAAGTACTTTCAAGTTAGCCTTGCGCGCTATCAAGCTATGGGCTCAGCGCCGTGCC
GTTTATGCCAACATCATGGGTTTCCCCGGCGGCGTGGCCTGGGCTATGCTGGTCGCTCGAGTGTGCCAGTTGTAC
CCGAAGGCAGCCACGTCCGTGATTGTCAACAAATTTTTCCTCGTCATTGGGCAGTGGCGGTGGCCACATCCTGTT
CTTCTCAAACCCATTGAGAGTGGTCCCCTTCCAGTCCGCGTCTGGAATCCGAAGGTGAGTGGTCCTTTTCCCGTC
TTGAGACGTCTGACCCATTGACGATAAGTCAGATCTACAAAGGTGACACTTTCCATCTCATGCCGGTCATCACTC
CAGCATATCCGTCAATGTGTGCCACATTCAATATTACTCGCTCTTCCATGGCGGTCATCAACAGAGAGCTTCAGC
GCGGCTTAAAACTGTCGGAAAACATCATGGTCGGCAAGAGTCCATGGAGCGATCTTTTCGTCAAGCACACATTCT
TCACGTCGGATTATAGATACTACATATCCGTCATTTCAGCTGCCAAGGACAAAGAAGCTCACAAAATTTGGTCGG
GCTACGTCGAGTCAAAAGTCCGCATGCTAGTACAGAAACTCGAGTTGCACCCAGCCATAGCGTTAGCACACGCCT
TCAATAAAGGCTACGACAGGCGTCATCGCTGTAAAGACGATCAGCAGATTGCTCAAGTGCAGGAAGGCTGTCTCG
ACTACATGATTAGCGCCGATGACGTGACCAAGGAAGCGGACAGCGGCCGAGATGTTGCGAAGACCGATGACGATT
CGGAGCCTGCCTCCTATACCGATGTATTCACAACTACTCATTACATCGGAATTCAACTTGTAGAAAGTGAGTGTT
CTTTGCGTAGCGGCCAGCAACAGATTAAGCTGTGAGTGAAGGGCAAGGCTGACATTGGCACAATAGAGGCAAAGT
CACTGGATTTGTCCTTCCAGGTGGACGAGTTTAAATCACTCTGCACTCAATGGAAGAAATTTCAAGACGATCTTC
GTACTTTGGTCTCCATCGGCGTTCAGCATGTGCGAAAGTAAATCGCGATGTGCTGCCCGGACGAATTAGGTATGA
TGGCTGACGGCGTACGCAGTGTCAATCTTCCCGACGACGTCTTCGAGGCGGGTGAAAAGAAGCCACAGAAAAAGG
GTGTCAAGCGGCCACCGATGGCAGAAAAGCGTGGCCCGTCAGAGGTCAGTATCCCAATGGAAACCTCATTGTGGC
GGGCACATATCGGCGGGTTCGTCGGATATGATGAACCAGTAGCATTGACTGTTGGGTAGGACAACGCTCCGCCGC
CAGCGAAGAGACACCAAACCTCCGTGGTTGCCGCCGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail