Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05639
Gene name
Locationscaffold_06:1491173..1491640
Strand-
Gene length (bp)467
Transcript length (bp)390
Coding sequence length (bp)390
Protein length (aa) 130

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 30 49 19
2 69 91 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05639
MHLAVGRTPAGRYGYFDLEEGLRQLALRRIWMSSVLIMVSIGGFNYFGLAVTRSVSATSRSTIDTCRTLFIWIVS
LVLSWESFKLLQIIGFAVLVYSTFVFNGIVPPPFRGLQDGDVEELLPEDPIEHQ*
Coding >Ophcf2|05639
ATGCACCTCGCTGTGGGCCGCACGCCGGCCGGCCGGTACGGTTATTTCGACCTAGAGGAAGGCTTGCGCCAACTA
GCGCTAAGACGCATCTGGATGTCGAGCGTGCTCATCATGGTGAGCATCGGTGGTTTCAACTACTTTGGACTTGCG
GTGACTCGCAGCGTCAGCGCTACCTCGAGGTCGACTATCGACACATGCAGGACGCTGTTCATTTGGATCGTATCT
CTGGTTCTCAGTTGGGAGTCGTTCAAGTTGCTCCAAATCATCGGGTTCGCCGTACTGGTCTACTCTACATTCGTG
TTCAATGGTATTGTTCCACCGCCATTTCGCGGTCTCCAGGATGGCGACGTAGAAGAGCTACTCCCAGAGGACCCC
ATAGAGCACCAATAA
Transcript >Ophcf2|05639
ATGCACCTCGCTGTGGGCCGCACGCCGGCCGGCCGGTACGGTTATTTCGACCTAGAGGAAGGCTTGCGCCAACTA
GCGCTAAGACGCATCTGGATGTCGAGCGTGCTCATCATGGTGAGCATCGGTGGTTTCAACTACTTTGGACTTGCG
GTGACTCGCAGCGTCAGCGCTACCTCGAGGTCGACTATCGACACATGCAGGACGCTGTTCATTTGGATCGTATCT
CTGGTTCTCAGTTGGGAGTCGTTCAAGTTGCTCCAAATCATCGGGTTCGCCGTACTGGTCTACTCTACATTCGTG
TTCAATGGTATTGTTCCACCGCCATTTCGCGGTCTCCAGGATGGCGACGTAGAAGAGCTACTCCCAGAGGACCCC
ATAGAGCACCAATAA
Gene >Ophcf2|05639
ATGCACCTCGCTGTGGGCCGCACGCCGGCCGGCCGGTACGGTTATTTCGACCTAGAGGAAGGCTTGCGCCAACTA
GCGCTAAGACGCATCTGGATGTCGAGCGTGCTCATCATGGTGAGCATCGGGTAAGAATCCCCATAACCCTGTTGC
GATCCTCCATGGATATGTTTACCTCCTGCTAAAGCTGTGTGTCTTTTCCCAGTGGTTTCAACTACTTTGGACTTG
CGGTGACTCGCAGCGTCAGCGCTACCTCGAGGTCGACTATCGACACATGCAGGACGCTGTTCATTTGGATCGTAT
CTCTGGTTCTCAGTTGGGAGTCGTTCAAGTTGCTCCAAATCATCGGGTTCGCCGTACTGGTCTACTCTACATTCG
TGTTCAATGGTATTGTTCCACCGCCATTTCGCGGTCTCCAGGATGGCGACGTAGAAGAGCTACTCCCAGAGGACC
CCATAGAGCACCAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail