Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05637
Gene name
Locationscaffold_06:1416926..1419040
Strand-
Gene length (bp)2114
Transcript length (bp)1806
Coding sequence length (bp)1806
Protein length (aa) 602

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00271 Helicase_C Helicase conserved C-terminal domain 5.6E-11 167 276
PF09369 MZB MrfA Zn-binding domain 2.4E-08 511 573

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Extracellular 0.5178 0.4808 0.6784 0.0586 0.3154 0.0064 0.1636 0.0145 0.0782 0.0858

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5172
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6679
Ophiocordyceps australis map64 (Brazil) OphauB2|4351
Ophiocordyceps camponoti-floridani Ophcf2|05637 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|986
Ophiocordyceps kimflemingae Ophio5|8248
Ophiocordyceps subramaniannii Hirsu2|3832

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05637
MLALVPGLEDMAVETLDGDTPMSKRNSIRDEARVIMTNPDMLHMTILPQEHKWRTFFSNLTLVVVDELHYYNGIL
GSHMAFIIRRLRRLCAANGNLLLKFVSCSATAANPKQHFETMLGLRNVSLIDCDGSPSGRKEFICWNTPLAIAGD
PSSGRKSAKSECALLFCALMLRGVRMIAFCRVRAQCEALVGAIREELMSLRRPECANMVMCYRGGYTAADRRMIE
SDMFEGKLMGIVATTALELGVDIGALDCVMTWGFPYTIANLRQQSGRAGRRNRDSLSILVGDCFPTDQHFMQNPD
ELFTRPNAELRVDLRNMIIREGHVQCAAFEMPIRPEQDSMYFGADLVKLCKDRLVADETGFFHCHDRFRPNPSRF
MAVRDTDPDHFAIVDTTMGGNKVLEELEASRAIFTLYDGAIFLHQGQSYLVKEFLPDKLLAKVEKVKVDWFTTQR
DYTDIDPIEIEAIRRISSSSSQVNHGTIRILQKVFGFLKVDKNGRILDAIEVDNPPIIRAPEDLRTECKIATKEF
ATTETQRKRPARLTFYDTKGGPTGSGITAKAFDYIDGLLKLALRRIEQFYSTLKLTLTNFRWAQKTASLRESRRQ
Y*
Coding >Ophcf2|05637
ATGCTAGCTTTGGTCCCAGGCCTCGAAGATATGGCCGTGGAAACTCTTGACGGCGACACTCCTATGAGCAAACGG
AACTCTATCCGAGACGAGGCGAGGGTTATCATGACGAACCCCGATATGCTCCATATGACAATTCTTCCTCAAGAG
CACAAATGGAGGACGTTTTTCAGCAACCTCACTTTAGTAGTTGTTGACGAACTCCACTACTATAACGGTATTCTA
GGCTCGCACATGGCCTTCATAATTCGAAGACTCAGACGGCTTTGCGCAGCTAATGGGAATCTACTCCTTAAATTC
GTCTCCTGTTCGGCCACCGCAGCGAATCCCAAGCAGCATTTCGAGACTATGCTTGGCTTGCGAAATGTGAGCCTA
ATTGACTGCGACGGCTCTCCATCAGGCCGCAAGGAGTTCATTTGCTGGAACACTCCGCTTGCCATTGCAGGCGAT
CCGTCCAGCGGCCGGAAAAGCGCCAAGTCTGAGTGTGCTTTGCTATTCTGCGCCCTGATGCTGAGGGGCGTTCGG
ATGATAGCCTTCTGCCGCGTTCGTGCACAATGCGAAGCGCTAGTGGGCGCAATTCGGGAAGAGTTGATGTCGCTC
CGACGCCCCGAGTGTGCCAACATGGTCATGTGCTACCGCGGCGGTTATACGGCGGCGGATCGCAGAATGATCGAG
TCTGACATGTTCGAGGGAAAGCTCATGGGCATCGTCGCGACCACGGCTTTGGAGCTTGGCGTCGACATAGGCGCA
CTCGATTGCGTCATGACTTGGGGGTTTCCTTACACGATAGCCAACCTCCGACAGCAGAGTGGCAGGGCTGGCCGA
CGTAATAGGGATTCTCTTTCCATCCTCGTTGGTGACTGCTTTCCGACCGACCAACATTTTATGCAGAACCCCGAT
GAGCTCTTTACGAGGCCCAATGCGGAACTTCGGGTGGATTTGAGGAACATGATTATTCGCGAGGGTCATGTTCAG
TGTGCAGCCTTCGAAATGCCCATTAGACCAGAACAAGACAGCATGTACTTTGGTGCGGATCTGGTCAAGTTATGC
AAGGATAGGCTTGTCGCCGACGAGACGGGATTTTTCCACTGCCACGATCGATTCCGTCCTAACCCATCGAGATTC
ATGGCCGTGCGGGACACCGATCCCGACCATTTTGCCATTGTTGATACCACAATGGGCGGGAACAAGGTGTTGGAG
GAACTGGAGGCTTCCAGGGCGATCTTTACCTTATACGACGGCGCCATATTTCTTCACCAGGGCCAAAGTTATCTC
GTCAAGGAATTTCTACCGGACAAGCTCTTAGCCAAGGTGGAAAAGGTCAAAGTAGACTGGTTCACGACGCAGCGA
GATTATACAGATATCGACCCAATCGAGATCGAAGCAATACGCAGAATATCGTCATCATCTTCACAGGTTAACCAT
GGCACGATCCGAATTCTGCAAAAGGTCTTCGGTTTTTTAAAGGTGGACAAGAATGGTCGAATCTTGGATGCAATC
GAAGTCGACAATCCACCAATCATTCGTGCGCCCGAAGATTTGCGGACCGAGTGCAAGATAGCGACCAAGGAGTTT
GCGACAACCGAGACGCAGAGGAAGCGGCCGGCTAGACTAACATTTTATGATACCAAAGGAGGGCCTACGGGGTCA
GGCATTACCGCAAAGGCCTTCGACTACATCGATGGCCTGCTCAAACTAGCGCTGCGGCGAATAGAACAATTCTAC
TCGACCTTGAAATTGACGTTGACCAACTTCCGATGGGCCCAGAAGACTGCATCCCTGCGGGAGTCGAGACGGCAG
TACTAG
Transcript >Ophcf2|05637
ATGCTAGCTTTGGTCCCAGGCCTCGAAGATATGGCCGTGGAAACTCTTGACGGCGACACTCCTATGAGCAAACGG
AACTCTATCCGAGACGAGGCGAGGGTTATCATGACGAACCCCGATATGCTCCATATGACAATTCTTCCTCAAGAG
CACAAATGGAGGACGTTTTTCAGCAACCTCACTTTAGTAGTTGTTGACGAACTCCACTACTATAACGGTATTCTA
GGCTCGCACATGGCCTTCATAATTCGAAGACTCAGACGGCTTTGCGCAGCTAATGGGAATCTACTCCTTAAATTC
GTCTCCTGTTCGGCCACCGCAGCGAATCCCAAGCAGCATTTCGAGACTATGCTTGGCTTGCGAAATGTGAGCCTA
ATTGACTGCGACGGCTCTCCATCAGGCCGCAAGGAGTTCATTTGCTGGAACACTCCGCTTGCCATTGCAGGCGAT
CCGTCCAGCGGCCGGAAAAGCGCCAAGTCTGAGTGTGCTTTGCTATTCTGCGCCCTGATGCTGAGGGGCGTTCGG
ATGATAGCCTTCTGCCGCGTTCGTGCACAATGCGAAGCGCTAGTGGGCGCAATTCGGGAAGAGTTGATGTCGCTC
CGACGCCCCGAGTGTGCCAACATGGTCATGTGCTACCGCGGCGGTTATACGGCGGCGGATCGCAGAATGATCGAG
TCTGACATGTTCGAGGGAAAGCTCATGGGCATCGTCGCGACCACGGCTTTGGAGCTTGGCGTCGACATAGGCGCA
CTCGATTGCGTCATGACTTGGGGGTTTCCTTACACGATAGCCAACCTCCGACAGCAGAGTGGCAGGGCTGGCCGA
CGTAATAGGGATTCTCTTTCCATCCTCGTTGGTGACTGCTTTCCGACCGACCAACATTTTATGCAGAACCCCGAT
GAGCTCTTTACGAGGCCCAATGCGGAACTTCGGGTGGATTTGAGGAACATGATTATTCGCGAGGGTCATGTTCAG
TGTGCAGCCTTCGAAATGCCCATTAGACCAGAACAAGACAGCATGTACTTTGGTGCGGATCTGGTCAAGTTATGC
AAGGATAGGCTTGTCGCCGACGAGACGGGATTTTTCCACTGCCACGATCGATTCCGTCCTAACCCATCGAGATTC
ATGGCCGTGCGGGACACCGATCCCGACCATTTTGCCATTGTTGATACCACAATGGGCGGGAACAAGGTGTTGGAG
GAACTGGAGGCTTCCAGGGCGATCTTTACCTTATACGACGGCGCCATATTTCTTCACCAGGGCCAAAGTTATCTC
GTCAAGGAATTTCTACCGGACAAGCTCTTAGCCAAGGTGGAAAAGGTCAAAGTAGACTGGTTCACGACGCAGCGA
GATTATACAGATATCGACCCAATCGAGATCGAAGCAATACGCAGAATATCGTCATCATCTTCACAGGTTAACCAT
GGCACGATCCGAATTCTGCAAAAGGTCTTCGGTTTTTTAAAGGTGGACAAGAATGGTCGAATCTTGGATGCAATC
GAAGTCGACAATCCACCAATCATTCGTGCGCCCGAAGATTTGCGGACCGAGTGCAAGATAGCGACCAAGGAGTTT
GCGACAACCGAGACGCAGAGGAAGCGGCCGGCTAGACTAACATTTTATGATACCAAAGGAGGGCCTACGGGGTCA
GGCATTACCGCAAAGGCCTTCGACTACATCGATGGCCTGCTCAAACTAGCGCTGCGGCGAATAGAACAATTCTAC
TCGACCTTGAAATTGACGTTGACCAACTTCCGATGGGCCCAGAAGACTGCATCCCTGCGGGAGTCGAGACGGCAG
TACTAG
Gene >Ophcf2|05637
ATGCTAGCTTTGGTCCCAGGCCTCGAAGATATGGCCGTGGAAACTCTTGACGGCGACACTCCTATGAGCAAACGG
AACTCTATCCGAGACGAGGCGAGGGTTATCATGACGAACCCCGATATGCTCCATATGACAATTCTTCCTCAAGAG
CACAAATGGAGGACGTTTTTCAGCAACCTCACTTTAGTAGTTGGTATGTCATTTCCTCAGTCCTTTTTCCACCCC
AAAGCTCGAGCTATTAGGCTTACCATTCATCACAATCATAGTTGACGAACTCCACTACTATAACGGTATTCTAGG
CTCGCACATGGCCTTCATAATTCGAAGACTCAGACGGCTTTGCGCAGCTAATGGGAATCTACTCCTTAAATTCGT
CTCCTGTTCGGCCACCGCAGCGAATCCCAAGCAGCATTTCGAGACTATGCTTGGCTTGCGAAATGTGAGCCTAAT
TGACTGCGACGGCTCTCCATCAGGCCGCAAGGAGTTCATTTGCTGGAACACTCCGCTTGCCATTGCAGGCGATCC
GTCCAGCGGCCGGAAAAGCGCCAAGTCTGAGTGTGCTTTGCTATTCTGCGCCCTGATGCTGAGGGGCGTTCGGAT
GATAGCCTTCTGCCGCGTTCGTGCACAATGCGAAGCGCTAGTGGGCGCAATTCGGGAAGAGTTGATGTCGCTCCG
ACGCCCCGAGTGTGCCAACATGGTCATGTGCTACCGCGGCGGTTATACGGCGGCGGATCGCAGAATGATCGAGTC
TGACATGTTCGAGGGAAAGCTCATGGGCATCGTCGCGACCACGGCTTTGGAGCTTGGCGTCGACATAGGCGCACT
CGATTGCGTCATGACTTGGGGGTTTCCTTACACGATAGCCAACCTCCGACAGCAGAGTGGCAGGGCTGGCCGACG
TAATAGGGATTCTCTTTCCATCCTCGTTGGTGACTGCTTTCCGACCGACCAACATTTTATGCAGAACCCCGATGA
GCTCTTTACGAGGCCCAATGCGGAACTTCGGGTGGATTTGAGGAACATGATTATTCGCGAGGGTCATGTTCAGTG
TGCAGCCTTCGAAATGCCCATTAGACCAGAACAAGACAGCATGTACTTTGGTGCGGATCTGGTCAAGTTATGCAA
GGATAGGCTTGTCGCCGACGAGACGGGATTTTTCCACTGCCACGATCGATTCCGTCCTAACCCATCGAGATTCAT
GGCCGTGCGGGACACCGATCCCGACCATTTTGCCATTGTTGATACCACAATGGGCGGGAACAAGGTGTTGGAGGA
ACTGGAGGCTTCCAGGGCGATCTTTACCTTATACGACGGCGCCATATTTCTTCACCAGGGCCAAAGTTATCTCGT
CAAGGAATTTCTACCGGACAAGCTCTTAGCCAAGGTGGAAAAGGTCAAAGTAGACTGGTTCACGACGCAGCGAGA
TTATACAGATATCGACCCAATCGAGATCGAAGCAATACGCAGAATATCGTCATCATCTTCACAGGTTAACCATGG
CACGATCCGAATTCTGCAAAAGGTCTTCGGTTTTTTAAAGGTGGACAAGAATGGTCGAATCTTGGATGCAATCGA
AGTCGACAATCCACCAATCATTCGGTATAGCAAAGGTATGTGGTTGGATGTGCCGGAACGAGCACTTGAAATCCT
GCAAGCCCGACAAATGAACTCAGCAGCCGCCATACATGCGGCGGAGCACGCTGTCATGAGTTTGCTTCCGACGCT
TGTCATCAGTGCGCCCGAAGATTTGCGGACCGAGTGCAAGATAGCGACCAAGGAGTTTGCGACAACCGAGACGCA
GAGGAAGCGGCCGGCTAGACTAACATTTTATGATACCAAAGGAGGGCCTACGGGGTCAGGCATTACCGCAAAGGC
CTTCGACTACATCGATGGCCTGCTCAAACTAGCGCTGCGGCGAATAGAACAATGTCAGTGCCTTCGGGGCTGCGT
TGAGTGTGTGGCATCCGAGACGTGCAAGGGGGCAAACGAGGTTATGAGTAAGGCTGGGAGCCAAGTCATCCTAAA
AAGTCTACTCGACCTTGAAATTGACGTTGACCAACTTCCGATGGGCCCAGAAGACTGCATCCCTGCGGGAGTCGA
GACGGCAGTACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail