Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05612
Gene name
Locationscaffold_06:686892..688491
Strand+
Gene length (bp)1599
Transcript length (bp)1440
Coding sequence length (bp)1440
Protein length (aa) 480

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00505 HMG_box HMG (high mobility group) box 2.3E-12 183 255
PF09011 HMG_box_2 HMG-box domain 7.0E-05 182 247

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2654 0.8926 0.0734 0.0155 0.1177 0.0021 0.0186 0.0415 0.0178 0.0378

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
HMG

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4982
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3496
Ophiocordyceps australis map64 (Brazil) OphauB2|3663
Ophiocordyceps camponoti-floridani Ophcf2|05612 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4787
Ophiocordyceps subramaniannii Hirsu2|2186

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05612
MVHHPLSPATSIAGLSSWDRSTDMRAGVYQPLPGVVAGGMTYRACQEEPRSSMDFRAPTSSPQLPMLSREQGEAS
GFTHAPFTPETSPLLSTDGEDFTTIRQVPTESGRSWAGNTCRREVGRIEKRRKAPRSGTKPGMLAKYIQLDKPLS
ECIKDDGDTEVFDVFAHVHRETRKNEVGNDGKVKRPLNAFLLYRKHVIIFVKKKFLQEENKNNQQLVSRICGDSW
KMETDEVKTKFKKLAQEEKSRHGEAFPLYKYTPKTIKKTENDGDGVKTETGARSASAGDRTLDSASPDAFKEHFE
ASYGSQPHVGLQEPRIMRESHVESSYTFAAQPPVGIGEQGQLHYPGYHDETGATSDYTYGWSHNGLSQAGNYGLE
ASVDMQPRAGPANNHELYIDPTLLPRVEEPVYHWRVNDDLLHENQCSWNPQSYMSNMVVAMPDLDINGAHEAYLK
GGQEDWETSQLGESDSFNDWMLQQESAAN*
Coding >Ophcf2|05612
ATGGTTCACCATCCGCTTTCACCGGCGACTTCCATCGCCGGTTTGTCTTCTTGGGACCGGTCAACAGACATGCGT
GCCGGCGTCTATCAACCTTTACCTGGCGTTGTCGCTGGCGGGATGACTTACAGGGCGTGTCAAGAAGAGCCCCGG
TCTTCGATGGATTTCCGCGCTCCCACGTCGTCTCCTCAACTACCCATGCTCAGCCGCGAACAAGGCGAAGCTTCA
GGTTTTACTCATGCCCCGTTTACACCCGAGACGTCACCGCTCTTGTCGACAGATGGGGAAGACTTCACCACGATC
CGCCAGGTCCCGACCGAGTCCGGGAGAAGCTGGGCCGGGAATACATGCCGGAGAGAAGTCGGCCGTATCGAGAAA
AGACGCAAGGCGCCTAGAAGCGGGACAAAACCCGGGATGCTCGCAAAGTATATCCAGCTTGACAAGCCGCTGAGC
GAATGCATCAAAGATGATGGCGATACCGAGGTCTTTGACGTCTTTGCACACGTCCACCGAGAGACACGCAAGAAT
GAGGTGGGAAACGACGGCAAAGTCAAGAGACCACTCAACGCCTTCCTTCTCTACCGGAAGCACGTTATCATCTTC
GTCAAGAAGAAGTTCCTGCAGGAGGAGAACAAGAACAACCAGCAGCTCGTTTCGAGAATATGTGGCGATTCGTGG
AAGATGGAGACGGATGAGGTCAAGACCAAGTTTAAGAAGTTGGCACAAGAGGAAAAGTCGAGACACGGAGAGGCC
TTTCCGCTTTACAAATATACCCCAAAGACGATCAAAAAGACGGAAAACGACGGAGATGGCGTCAAGACGGAAACC
GGTGCGAGGTCAGCGTCTGCTGGTGACAGGACCCTTGATTCCGCTTCCCCGGACGCGTTCAAGGAACACTTTGAA
GCCAGCTACGGATCTCAGCCGCATGTTGGTCTGCAAGAGCCTCGGATTATGCGCGAGTCGCACGTTGAGAGCTCC
TACACGTTTGCGGCCCAGCCTCCCGTTGGCATTGGCGAACAGGGGCAGCTGCACTATCCTGGATACCACGACGAA
ACTGGCGCCACAAGCGATTATACATACGGCTGGAGCCACAACGGACTGTCGCAGGCTGGCAATTATGGTCTGGAG
GCGTCGGTGGATATGCAACCGCGGGCGGGCCCTGCCAACAACCACGAGCTCTACATTGACCCGACCCTCCTACCC
AGGGTAGAGGAGCCCGTGTATCATTGGCGTGTCAATGATGATCTGTTGCACGAGAACCAATGCAGCTGGAATCCG
CAGAGCTACATGAGCAACATGGTGGTGGCCATGCCGGACCTGGACATCAATGGAGCGCATGAGGCATACCTAAAA
GGAGGACAGGAAGACTGGGAGACTTCACAGCTGGGTGAGTCCGACAGCTTCAACGACTGGATGTTGCAACAGGAG
AGTGCCGCCAACTGA
Transcript >Ophcf2|05612
ATGGTTCACCATCCGCTTTCACCGGCGACTTCCATCGCCGGTTTGTCTTCTTGGGACCGGTCAACAGACATGCGT
GCCGGCGTCTATCAACCTTTACCTGGCGTTGTCGCTGGCGGGATGACTTACAGGGCGTGTCAAGAAGAGCCCCGG
TCTTCGATGGATTTCCGCGCTCCCACGTCGTCTCCTCAACTACCCATGCTCAGCCGCGAACAAGGCGAAGCTTCA
GGTTTTACTCATGCCCCGTTTACACCCGAGACGTCACCGCTCTTGTCGACAGATGGGGAAGACTTCACCACGATC
CGCCAGGTCCCGACCGAGTCCGGGAGAAGCTGGGCCGGGAATACATGCCGGAGAGAAGTCGGCCGTATCGAGAAA
AGACGCAAGGCGCCTAGAAGCGGGACAAAACCCGGGATGCTCGCAAAGTATATCCAGCTTGACAAGCCGCTGAGC
GAATGCATCAAAGATGATGGCGATACCGAGGTCTTTGACGTCTTTGCACACGTCCACCGAGAGACACGCAAGAAT
GAGGTGGGAAACGACGGCAAAGTCAAGAGACCACTCAACGCCTTCCTTCTCTACCGGAAGCACGTTATCATCTTC
GTCAAGAAGAAGTTCCTGCAGGAGGAGAACAAGAACAACCAGCAGCTCGTTTCGAGAATATGTGGCGATTCGTGG
AAGATGGAGACGGATGAGGTCAAGACCAAGTTTAAGAAGTTGGCACAAGAGGAAAAGTCGAGACACGGAGAGGCC
TTTCCGCTTTACAAATATACCCCAAAGACGATCAAAAAGACGGAAAACGACGGAGATGGCGTCAAGACGGAAACC
GGTGCGAGGTCAGCGTCTGCTGGTGACAGGACCCTTGATTCCGCTTCCCCGGACGCGTTCAAGGAACACTTTGAA
GCCAGCTACGGATCTCAGCCGCATGTTGGTCTGCAAGAGCCTCGGATTATGCGCGAGTCGCACGTTGAGAGCTCC
TACACGTTTGCGGCCCAGCCTCCCGTTGGCATTGGCGAACAGGGGCAGCTGCACTATCCTGGATACCACGACGAA
ACTGGCGCCACAAGCGATTATACATACGGCTGGAGCCACAACGGACTGTCGCAGGCTGGCAATTATGGTCTGGAG
GCGTCGGTGGATATGCAACCGCGGGCGGGCCCTGCCAACAACCACGAGCTCTACATTGACCCGACCCTCCTACCC
AGGGTAGAGGAGCCCGTGTATCATTGGCGTGTCAATGATGATCTGTTGCACGAGAACCAATGCAGCTGGAATCCG
CAGAGCTACATGAGCAACATGGTGGTGGCCATGCCGGACCTGGACATCAATGGAGCGCATGAGGCATACCTAAAA
GGAGGACAGGAAGACTGGGAGACTTCACAGCTGGGTGAGTCCGACAGCTTCAACGACTGGATGTTGCAACAGGAG
AGTGCCGCCAACTGA
Gene >Ophcf2|05612
ATGGTTCACCATCCGCTTTCACCGGCGACTTCCATCGCCGGTTTGTCTTCTTGGGACCGGTCAACAGACATGCGT
GCCGGCGTCTATCAACCTTTACCTGGCGTTGTCGCTGGTGAGCTCTTTGAACCGTATCTTTTTAGATACCCCAAC
TTACTCTTCGGAGGCGGGATGACTTACAGGGCGTGTCAAGAAGAGCCCCGGTCTTCGGTCAGTCGATTCGTTCCG
AGTCGTCCTCGTGTGCGTGCGATGCTAACTCTGATAGATGGATTTCCGCGCTCCCACGTCGTCTCCTCAACTACC
CATGCTCAGCCGCGAACAAGGCGAAGCTTCAGGTTTTGTAAGTCAGGACACGAGGCAATGGACGAGGTAAATTGC
TGACGCAGTAACCAGACTCATGCCCCGTTTACACCCGAGACGTCACCGCTCTTGTCGACAGATGGGGAAGACTTC
ACCACGATCCGCCAGGTCCCGACCGAGTCCGGGAGAAGCTGGGCCGGGAATACATGCCGGAGAGAAGTCGGCCGT
ATCGAGAAAAGACGCAAGGCGCCTAGAAGCGGGACAAAACCCGGGATGCTCGCAAAGTATATCCAGCTTGACAAG
CCGCTGAGCGAATGCATCAAAGATGATGGCGATACCGAGGTCTTTGACGTCTTTGCACACGTCCACCGAGAGACA
CGCAAGAATGAGGTGGGAAACGACGGCAAAGTCAAGAGACCACTCAACGCCTTCCTTCTCTACCGGAAGCACGTT
ATCATCTTCGTCAAGAAGAAGTTCCTGCAGGAGGAGAACAAGAACAACCAGCAGCTCGTTTCGAGAATATGTGGC
GATTCGTGGAAGATGGAGACGGATGAGGTCAAGACCAAGTTTAAGAAGTTGGCACAAGAGGAAAAGTCGAGACAC
GGAGAGGCCTTTCCGCTTTACAAATATACCCCAAAGACGATCAAAAAGACGGAAAACGACGGAGATGGCGTCAAG
ACGGAAACCGGTGCGAGGTCAGCGTCTGCTGGTGACAGGACCCTTGATTCCGCTTCCCCGGACGCGTTCAAGGAA
CACTTTGAAGCCAGCTACGGATCTCAGCCGCATGTTGGTCTGCAAGAGCCTCGGATTATGCGCGAGTCGCACGTT
GAGAGCTCCTACACGTTTGCGGCCCAGCCTCCCGTTGGCATTGGCGAACAGGGGCAGCTGCACTATCCTGGATAC
CACGACGAAACTGGCGCCACAAGCGATTATACATACGGCTGGAGCCACAACGGACTGTCGCAGGCTGGCAATTAT
GGTCTGGAGGCGTCGGTGGATATGCAACCGCGGGCGGGCCCTGCCAACAACCACGAGCTCTACATTGACCCGACC
CTCCTACCCAGGGTAGAGGAGCCCGTGTATCATTGGCGTGTCAATGATGATCTGTTGCACGAGAACCAATGCAGC
TGGAATCCGCAGAGCTACATGAGCAACATGGTGGTGGCCATGCCGGACCTGGACATCAATGGAGCGCATGAGGCA
TACCTAAAAGGAGGACAGGAAGACTGGGAGACTTCACAGCTGGGTGAGTCCGACAGCTTCAACGACTGGATGTTG
CAACAGGAGAGTGCCGCCAACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail