Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05610
Gene name
Locationscaffold_06:676843..683007
Strand-
Gene length (bp)6164
Transcript length (bp)4545
Coding sequence length (bp)4545
Protein length (aa) 1515

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19326 AMP_deaminase AMP deaminase 5.0E-287 166 787
PF07690 MFS_1 Major Facilitator Superfamily 3.8E-35 1015 1423
PF00962 A_deaminase Adenosine deaminase 2.2E-11 615 743

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0003876 AMP deaminase activity Yes
GO:0032264 IMP salvage Yes
GO:0019239 deaminase activity Yes
GO:0055085 transmembrane transport Yes
GO:0072522 purine-containing compound biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:0009124 nucleoside monophosphate biosynthetic process No
GO:0009123 nucleoside monophosphate metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0005215 transporter activity No
GO:0009150 purine ribonucleotide metabolic process No
GO:0047623 adenosine-phosphate deaminase activity No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0006163 purine nucleotide metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0106380 purine ribonucleotide salvage No
GO:0003824 catalytic activity No
GO:0009126 purine nucleoside monophosphate metabolic process No
GO:0009165 nucleotide biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0051234 establishment of localization No
GO:0043173 nucleotide salvage No
GO:0009127 purine nucleoside monophosphate biosynthetic process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0009987 cellular process No
GO:0006810 transport No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009260 ribonucleotide biosynthetic process No
GO:0046040 IMP metabolic process No
GO:0072521 purine-containing compound metabolic process No
GO:0009167 purine ribonucleoside monophosphate metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044281 small molecule metabolic process No
GO:0009161 ribonucleoside monophosphate metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0009152 purine ribonucleotide biosynthetic process No
GO:0046390 ribose phosphate biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0019693 ribose phosphate metabolic process No
GO:0043094 cellular metabolic compound salvage No
GO:0019438 aromatic compound biosynthetic process No
GO:0008150 biological_process No
GO:0006164 purine nucleotide biosynthetic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0009156 ribonucleoside monophosphate biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0006793 phosphorus metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0051179 localization No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No
GO:0032261 purine nucleotide salvage No
GO:0009168 purine ribonucleoside monophosphate biosynthetic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0016787 hydrolase activity No
GO:0006188 IMP biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0090407 organophosphate biosynthetic process No
GO:0009117 nucleotide metabolic process No
GO:0043101 purine-containing compound salvage No
GO:0016814 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines No
GO:0009259 ribonucleotide metabolic process No
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.45

Transmembrane Domains

Domain # Start End Length
1 1005 1024 19
2 1045 1067 22
3 1077 1094 17
4 1135 1157 22
5 1162 1184 22
6 1204 1221 17
7 1236 1258 22
8 1279 1298 19
9 1313 1335 22
10 1347 1369 22
11 1374 1396 22
12 1470 1492 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05610
MTDNQALHQSLERFNGHDGSFEDCAAEENETLLPSPGTPYAVEHDAFQGDILPRDVPKRTTFYDPVAERQMTHTD
AKLFYQRSQIDSRGRAPATEYGGGSLTLDHVNVIPDGDDHFRNSEQPFPTTTTGRHATFHASDGIFDGKLRTDST
AGFTNSSLFDTEPHITSELSAISKNIQKILNFRRKYLSLSLQGPSDNPRDDPSWEIYPPPPEPAWAQSDVGNGKL
RERSQSPSDRKGHNVAEEFTMEHLLPLPDEDELDYRLDDSGVYQVVESDLPVIRVPTIREFYMDLEEILAISSDG
PSKSFAFRRLQYLEAKFNLYILLNEYQETADSKKVPHRDFYNVRKVDTHVHHSACMNQKHLLRFIKSKMKKHPNE
VVLFRDDKHLTLAEVFASINLTAYDLSIDTLDMHAHTDSFHRFDKFNLKYNPIGESRLRTIFLKTDNFIHGRYLA
EITKEVISDLESSKYQMVEWRISIYGKSIDEWDKLAAWVVDNKLFSHNVRWLIQIPRLYDVYQASGLMQTYEQIV
INLFRPLFEVTKNPSSHPKLHVFLQRVIGFDSVDDESKVERRLFRKFPVPRAWNSKQNPPYSYWLYYLFANMTSL
NFWRRRRGFNTFVLRPHCGEAGDSEHLAVAVLACHSISHGLLLRKVPLLQYIFYLEQIGIAMSPLSNNALFLAYE
RNPFHQYFRRGLNVSLSTDDPLQFAFTKEALIEEYAVAAQIYKLSSVDMCELAKNSVKQSGYESSIKRQWLGPHY
ELPGKLGNVMVKTNVPDRREEFRYQTLLQERDVLRRYVTYKSQRDASEDRIDGVESSHQQGDPGYKPPPMTDGAL
VQEPERLSEHIQIQPSDFLIPLNKTTTALASVRHDNISPCFYLFRLSPPTSLFSWRITNLANPILVSLLTLALTK
PDLCLNFLSWKQPLSPESDTSSDQPSTDTAQFAQMANNSSSDVHGASSQRCSVTGDAPAAASIEEAASGEELNSI
SKFEVQDSGREEAWPSGSGGLSNSTPAISIHRFWLFTFGVCLGLFLSLVDSSIIATSLYSIGVEFGSFKSVNWVA
LAYTLAYLGCAVTFASLSDVLGMRQAFLLSYVLFFAFSLACGFARDLPQLICFRALQGVGGSGLYSLSMIILPEI
CPKERQAHIGSIIGIVIACSGVMGPVLGGVLTHYASWRWVFWINGPVGLVSLTILLVAWPKEEYVGLMRRRSWRD
FDVVGSFLVIASSVLVVFAFQNAGEAERDHVWCDAIFIAPLVAGLFGWMALLAWALRVKTRFSDSFSLAFPLSLF
RNKMYAAGAASTLLLGYPYLLIMYSFPLRAQVVSEKSALVAGLMLLPMLVMSALGSAISGKINTKAPRFQATLLF
GASFMTVGTALLTTVTGSWDDTKALGFLTFCGLGFGLSTAAATNLVTIEAPSRDQATAHGILAQLRVLGGSLGIS
TSTILVQAEARTRLAGILTGASVEREGGGLPHVQRAAVREAYARAFSKGMIAAAVVSVVAFVILVGIRCCKTTPR
GSSTGSDEPQRMEM*
Coding >Ophcf2|05610
ATGACTGATAATCAAGCTCTGCATCAGAGCTTAGAACGCTTCAATGGCCACGACGGGAGCTTCGAGGACTGTGCC
GCAGAGGAGAATGAAACGCTTCTACCCTCGCCGGGTACGCCGTATGCCGTGGAACACGATGCTTTTCAAGGCGAC
ATACTTCCACGGGACGTTCCCAAGCGCACAACATTTTACGACCCGGTCGCCGAGCGCCAAATGACGCATACAGAT
GCCAAGCTGTTCTACCAGCGCAGCCAGATCGACTCTCGTGGCAGAGCTCCTGCCACAGAATACGGCGGAGGCTCT
TTGACTCTTGATCACGTAAATGTTATTCCTGACGGTGATGATCATTTCAGAAACAGCGAGCAGCCTTTTCCGACC
ACAACTACCGGACGGCACGCTACCTTTCACGCAAGCGACGGCATCTTCGACGGCAAACTACGGACGGATTCTACA
GCTGGTTTCACTAACAGCAGCCTATTCGACACAGAACCGCATATCACATCCGAGCTCAGTGCCATTTCAAAGAAC
ATCCAGAAGATACTGAATTTTCGACGGAAGTACCTCTCTCTATCTTTACAAGGGCCTTCGGACAACCCTCGCGAC
GACCCAAGTTGGGAAATTTACCCTCCTCCTCCCGAGCCTGCGTGGGCGCAGAGCGATGTCGGTAACGGGAAGCTG
CGGGAGCGCTCCCAATCTCCGAGTGACCGTAAGGGCCACAATGTGGCCGAGGAATTTACTATGGAACACCTCTTG
CCATTGCCCGACGAGGATGAGTTGGATTATAGACTCGATGACAGTGGTGTGTACCAGGTAGTGGAGTCTGACTTG
CCCGTTATTCGAGTTCCAACCATCAGGGAGTTTTATATGGACCTGGAAGAGATTCTCGCCATCTCGTCGGACGGC
CCAAGTAAAAGCTTTGCGTTTAGGCGGCTTCAGTATCTGGAAGCAAAATTCAATCTATACATCCTACTCAACGAA
TACCAAGAGACAGCCGACAGCAAAAAGGTGCCTCACCGAGACTTTTATAACGTTCGCAAGGTAGACACGCACGTT
CACCACTCGGCGTGTATGAACCAAAAGCATCTGCTTCGCTTCATTAAGAGCAAGATGAAGAAGCATCCCAACGAG
GTGGTTCTGTTTCGCGACGATAAGCATTTGACTCTAGCCGAGGTGTTTGCCAGCATTAACTTGACGGCCTATGAC
TTGAGCATCGACACTTTGGATATGCATGCACACACCGACTCGTTTCATCGTTTTGATAAATTTAATCTCAAGTAC
AACCCCATCGGAGAGTCTCGTCTTCGAACCATTTTCCTCAAGACCGACAACTTCATCCACGGACGTTACTTGGCT
GAGATCACCAAGGAAGTCATCTCGGATTTGGAGTCCAGCAAGTACCAAATGGTGGAGTGGCGCATTTCAATCTAT
GGCAAATCCATAGACGAGTGGGACAAACTGGCCGCCTGGGTCGTGGACAACAAGCTTTTCTCGCACAATGTGCGG
TGGCTAATTCAGATCCCTCGCCTGTACGACGTTTACCAAGCAAGCGGGCTCATGCAGACCTACGAGCAAATCGTC
ATCAACCTGTTCCGGCCTTTGTTCGAGGTGACGAAAAACCCGTCGAGCCATCCGAAACTGCATGTTTTCCTTCAG
CGGGTGATAGGGTTTGATAGCGTCGACGATGAGAGCAAGGTCGAGAGGAGGCTGTTTAGGAAGTTCCCGGTGCCG
CGTGCGTGGAATTCGAAACAGAACCCCCCCTACAGCTACTGGCTTTACTACCTGTTCGCGAACATGACGTCGCTC
AACTTTTGGCGGAGGCGACGGGGATTCAACACCTTCGTCCTACGGCCTCACTGTGGCGAAGCTGGCGACAGCGAG
CACTTGGCAGTTGCTGTCCTCGCCTGCCACAGTATCAGCCACGGGCTGCTGCTCCGAAAGGTGCCGCTTCTGCAG
TACATCTTCTATCTGGAACAGATTGGCATCGCCATGTCACCACTCAGCAACAATGCTTTGTTCCTCGCGTACGAA
CGCAACCCTTTCCACCAATACTTTCGGCGAGGACTCAACGTCTCGCTGTCTACGGATGACCCGCTGCAGTTCGCT
TTCACTAAGGAGGCCTTGATTGAGGAATACGCGGTTGCGGCGCAGATCTACAAGCTCAGTTCCGTCGATATGTGC
GAACTTGCCAAGAACTCTGTCAAGCAAAGTGGCTACGAGTCTTCCATTAAGCGGCAATGGCTGGGGCCGCACTAC
GAACTGCCCGGAAAGCTGGGCAACGTCATGGTCAAGACAAACGTTCCTGATCGGAGGGAGGAATTCCGCTACCAA
ACTCTTCTCCAGGAGCGAGACGTCTTGAGACGCTATGTGACGTACAAATCGCAGCGCGATGCGTCCGAAGACAGG
ATAGATGGCGTTGAATCATCGCATCAACAGGGCGATCCTGGCTACAAGCCGCCGCCCATGACGGACGGCGCACTG
GTTCAGGAGCCAGAACGACTGTCGGAGCACATACAGATACAGCCCTCCGATTTTCTCATCCCGCTAAATAAGACG
ACGACGGCCTTGGCCTCTGTTCGACATGACAATATCTCGCCTTGCTTCTACCTTTTTAGACTATCACCACCTACC
AGTCTGTTCTCTTGGAGAATTACAAACCTGGCCAATCCGATCCTGGTCTCTCTCCTCACCCTCGCTCTCACCAAG
CCCGATCTTTGTCTCAACTTTCTCTCCTGGAAACAGCCCCTATCACCGGAGAGTGACACCTCGTCAGATCAGCCA
TCGACAGACACAGCGCAGTTCGCTCAAATGGCCAACAACTCGAGCAGCGACGTCCACGGCGCATCGAGCCAGCGC
TGTTCGGTCACTGGCGACGCTCCCGCAGCGGCGAGCATCGAAGAAGCTGCGTCTGGCGAGGAGCTCAACAGCATA
AGCAAGTTTGAAGTTCAGGATTCCGGACGAGAAGAAGCCTGGCCTTCCGGTTCCGGCGGTCTTTCAAATTCAACA
CCTGCAATCTCCATCCACCGCTTCTGGCTGTTCACTTTTGGCGTGTGTCTCGGCCTGTTTCTCTCCTTGGTCGAT
TCGTCCATCATTGCGACCAGTCTGTATTCCATCGGCGTCGAATTTGGATCCTTCAAGTCTGTCAACTGGGTGGCA
CTGGCCTACACGCTGGCCTATCTAGGTTGCGCCGTCACGTTCGCCAGCTTGTCCGACGTGTTAGGCATGCGTCAA
GCCTTCCTCCTGTCCTATGTTCTCTTTTTCGCCTTCTCACTGGCGTGCGGGTTTGCTCGAGACCTGCCTCAGTTG
ATCTGCTTCCGCGCTCTTCAGGGCGTAGGCGGCTCGGGACTCTACTCCTTGTCTATGATCATTCTGCCCGAGATA
TGCCCCAAGGAACGTCAGGCGCACATTGGCTCCATCATAGGAATCGTCATAGCCTGCTCCGGCGTCATGGGTCCG
GTTCTTGGGGGCGTCCTCACCCATTACGCAAGTTGGCGCTGGGTCTTCTGGATCAACGGGCCCGTCGGTTTAGTC
TCCCTAACCATCTTACTTGTGGCATGGCCCAAAGAAGAGTACGTTGGCTTGATGCGACGACGCTCATGGCGCGAC
TTTGACGTCGTCGGCTCTTTCCTGGTCATTGCGTCCTCCGTCTTGGTCGTCTTTGCATTCCAAAATGCTGGCGAG
GCCGAGCGCGACCATGTTTGGTGTGACGCCATCTTCATCGCTCCGTTGGTCGCCGGACTCTTCGGCTGGATGGCT
CTGCTTGCATGGGCTTTGCGGGTTAAGACGCGATTTAGCGACTCCTTCTCGTTGGCTTTCCCACTCAGCCTCTTT
CGAAACAAGATGTACGCGGCCGGTGCTGCGTCGACGCTGCTCCTGGGTTACCCCTATCTTCTGATCATGTACTCC
TTCCCGCTCAGAGCACAGGTTGTGAGTGAGAAATCGGCGCTCGTGGCGGGACTCATGCTGCTACCGATGCTGGTG
ATGTCGGCCCTGGGGAGCGCCATCAGTGGCAAGATTAACACCAAGGCTCCCCGCTTCCAGGCCACATTGCTCTTC
GGAGCAAGCTTCATGACGGTTGGCACCGCGCTGCTCACGACCGTAACTGGTTCTTGGGACGACACAAAGGCTCTC
GGGTTCCTGACCTTTTGCGGGCTTGGATTTGGCCTCTCTACGGCTGCGGCCACGAATCTCGTCACTATTGAAGCT
CCCTCACGCGATCAGGCAACGGCACACGGCATCCTGGCGCAGCTCCGAGTTCTTGGCGGCAGCTTGGGCATATCA
ACCTCGACGATTCTAGTACAAGCCGAGGCCAGAACACGACTGGCAGGCATCCTGACCGGGGCCTCAGTGGAAAGA
GAGGGGGGCGGTTTGCCGCACGTTCAGCGGGCCGCAGTCCGCGAAGCATACGCCAGAGCCTTTTCCAAAGGCATG
ATTGCAGCTGCCGTCGTCTCGGTAGTTGCCTTCGTCATTCTCGTTGGAATTCGCTGCTGCAAGACGACGCCCCGA
GGCAGTTCCACGGGATCCGACGAACCTCAGCGTATGGAAATGTAG
Transcript >Ophcf2|05610
ATGACTGATAATCAAGCTCTGCATCAGAGCTTAGAACGCTTCAATGGCCACGACGGGAGCTTCGAGGACTGTGCC
GCAGAGGAGAATGAAACGCTTCTACCCTCGCCGGGTACGCCGTATGCCGTGGAACACGATGCTTTTCAAGGCGAC
ATACTTCCACGGGACGTTCCCAAGCGCACAACATTTTACGACCCGGTCGCCGAGCGCCAAATGACGCATACAGAT
GCCAAGCTGTTCTACCAGCGCAGCCAGATCGACTCTCGTGGCAGAGCTCCTGCCACAGAATACGGCGGAGGCTCT
TTGACTCTTGATCACGTAAATGTTATTCCTGACGGTGATGATCATTTCAGAAACAGCGAGCAGCCTTTTCCGACC
ACAACTACCGGACGGCACGCTACCTTTCACGCAAGCGACGGCATCTTCGACGGCAAACTACGGACGGATTCTACA
GCTGGTTTCACTAACAGCAGCCTATTCGACACAGAACCGCATATCACATCCGAGCTCAGTGCCATTTCAAAGAAC
ATCCAGAAGATACTGAATTTTCGACGGAAGTACCTCTCTCTATCTTTACAAGGGCCTTCGGACAACCCTCGCGAC
GACCCAAGTTGGGAAATTTACCCTCCTCCTCCCGAGCCTGCGTGGGCGCAGAGCGATGTCGGTAACGGGAAGCTG
CGGGAGCGCTCCCAATCTCCGAGTGACCGTAAGGGCCACAATGTGGCCGAGGAATTTACTATGGAACACCTCTTG
CCATTGCCCGACGAGGATGAGTTGGATTATAGACTCGATGACAGTGGTGTGTACCAGGTAGTGGAGTCTGACTTG
CCCGTTATTCGAGTTCCAACCATCAGGGAGTTTTATATGGACCTGGAAGAGATTCTCGCCATCTCGTCGGACGGC
CCAAGTAAAAGCTTTGCGTTTAGGCGGCTTCAGTATCTGGAAGCAAAATTCAATCTATACATCCTACTCAACGAA
TACCAAGAGACAGCCGACAGCAAAAAGGTGCCTCACCGAGACTTTTATAACGTTCGCAAGGTAGACACGCACGTT
CACCACTCGGCGTGTATGAACCAAAAGCATCTGCTTCGCTTCATTAAGAGCAAGATGAAGAAGCATCCCAACGAG
GTGGTTCTGTTTCGCGACGATAAGCATTTGACTCTAGCCGAGGTGTTTGCCAGCATTAACTTGACGGCCTATGAC
TTGAGCATCGACACTTTGGATATGCATGCACACACCGACTCGTTTCATCGTTTTGATAAATTTAATCTCAAGTAC
AACCCCATCGGAGAGTCTCGTCTTCGAACCATTTTCCTCAAGACCGACAACTTCATCCACGGACGTTACTTGGCT
GAGATCACCAAGGAAGTCATCTCGGATTTGGAGTCCAGCAAGTACCAAATGGTGGAGTGGCGCATTTCAATCTAT
GGCAAATCCATAGACGAGTGGGACAAACTGGCCGCCTGGGTCGTGGACAACAAGCTTTTCTCGCACAATGTGCGG
TGGCTAATTCAGATCCCTCGCCTGTACGACGTTTACCAAGCAAGCGGGCTCATGCAGACCTACGAGCAAATCGTC
ATCAACCTGTTCCGGCCTTTGTTCGAGGTGACGAAAAACCCGTCGAGCCATCCGAAACTGCATGTTTTCCTTCAG
CGGGTGATAGGGTTTGATAGCGTCGACGATGAGAGCAAGGTCGAGAGGAGGCTGTTTAGGAAGTTCCCGGTGCCG
CGTGCGTGGAATTCGAAACAGAACCCCCCCTACAGCTACTGGCTTTACTACCTGTTCGCGAACATGACGTCGCTC
AACTTTTGGCGGAGGCGACGGGGATTCAACACCTTCGTCCTACGGCCTCACTGTGGCGAAGCTGGCGACAGCGAG
CACTTGGCAGTTGCTGTCCTCGCCTGCCACAGTATCAGCCACGGGCTGCTGCTCCGAAAGGTGCCGCTTCTGCAG
TACATCTTCTATCTGGAACAGATTGGCATCGCCATGTCACCACTCAGCAACAATGCTTTGTTCCTCGCGTACGAA
CGCAACCCTTTCCACCAATACTTTCGGCGAGGACTCAACGTCTCGCTGTCTACGGATGACCCGCTGCAGTTCGCT
TTCACTAAGGAGGCCTTGATTGAGGAATACGCGGTTGCGGCGCAGATCTACAAGCTCAGTTCCGTCGATATGTGC
GAACTTGCCAAGAACTCTGTCAAGCAAAGTGGCTACGAGTCTTCCATTAAGCGGCAATGGCTGGGGCCGCACTAC
GAACTGCCCGGAAAGCTGGGCAACGTCATGGTCAAGACAAACGTTCCTGATCGGAGGGAGGAATTCCGCTACCAA
ACTCTTCTCCAGGAGCGAGACGTCTTGAGACGCTATGTGACGTACAAATCGCAGCGCGATGCGTCCGAAGACAGG
ATAGATGGCGTTGAATCATCGCATCAACAGGGCGATCCTGGCTACAAGCCGCCGCCCATGACGGACGGCGCACTG
GTTCAGGAGCCAGAACGACTGTCGGAGCACATACAGATACAGCCCTCCGATTTTCTCATCCCGCTAAATAAGACG
ACGACGGCCTTGGCCTCTGTTCGACATGACAATATCTCGCCTTGCTTCTACCTTTTTAGACTATCACCACCTACC
AGTCTGTTCTCTTGGAGAATTACAAACCTGGCCAATCCGATCCTGGTCTCTCTCCTCACCCTCGCTCTCACCAAG
CCCGATCTTTGTCTCAACTTTCTCTCCTGGAAACAGCCCCTATCACCGGAGAGTGACACCTCGTCAGATCAGCCA
TCGACAGACACAGCGCAGTTCGCTCAAATGGCCAACAACTCGAGCAGCGACGTCCACGGCGCATCGAGCCAGCGC
TGTTCGGTCACTGGCGACGCTCCCGCAGCGGCGAGCATCGAAGAAGCTGCGTCTGGCGAGGAGCTCAACAGCATA
AGCAAGTTTGAAGTTCAGGATTCCGGACGAGAAGAAGCCTGGCCTTCCGGTTCCGGCGGTCTTTCAAATTCAACA
CCTGCAATCTCCATCCACCGCTTCTGGCTGTTCACTTTTGGCGTGTGTCTCGGCCTGTTTCTCTCCTTGGTCGAT
TCGTCCATCATTGCGACCAGTCTGTATTCCATCGGCGTCGAATTTGGATCCTTCAAGTCTGTCAACTGGGTGGCA
CTGGCCTACACGCTGGCCTATCTAGGTTGCGCCGTCACGTTCGCCAGCTTGTCCGACGTGTTAGGCATGCGTCAA
GCCTTCCTCCTGTCCTATGTTCTCTTTTTCGCCTTCTCACTGGCGTGCGGGTTTGCTCGAGACCTGCCTCAGTTG
ATCTGCTTCCGCGCTCTTCAGGGCGTAGGCGGCTCGGGACTCTACTCCTTGTCTATGATCATTCTGCCCGAGATA
TGCCCCAAGGAACGTCAGGCGCACATTGGCTCCATCATAGGAATCGTCATAGCCTGCTCCGGCGTCATGGGTCCG
GTTCTTGGGGGCGTCCTCACCCATTACGCAAGTTGGCGCTGGGTCTTCTGGATCAACGGGCCCGTCGGTTTAGTC
TCCCTAACCATCTTACTTGTGGCATGGCCCAAAGAAGAGTACGTTGGCTTGATGCGACGACGCTCATGGCGCGAC
TTTGACGTCGTCGGCTCTTTCCTGGTCATTGCGTCCTCCGTCTTGGTCGTCTTTGCATTCCAAAATGCTGGCGAG
GCCGAGCGCGACCATGTTTGGTGTGACGCCATCTTCATCGCTCCGTTGGTCGCCGGACTCTTCGGCTGGATGGCT
CTGCTTGCATGGGCTTTGCGGGTTAAGACGCGATTTAGCGACTCCTTCTCGTTGGCTTTCCCACTCAGCCTCTTT
CGAAACAAGATGTACGCGGCCGGTGCTGCGTCGACGCTGCTCCTGGGTTACCCCTATCTTCTGATCATGTACTCC
TTCCCGCTCAGAGCACAGGTTGTGAGTGAGAAATCGGCGCTCGTGGCGGGACTCATGCTGCTACCGATGCTGGTG
ATGTCGGCCCTGGGGAGCGCCATCAGTGGCAAGATTAACACCAAGGCTCCCCGCTTCCAGGCCACATTGCTCTTC
GGAGCAAGCTTCATGACGGTTGGCACCGCGCTGCTCACGACCGTAACTGGTTCTTGGGACGACACAAAGGCTCTC
GGGTTCCTGACCTTTTGCGGGCTTGGATTTGGCCTCTCTACGGCTGCGGCCACGAATCTCGTCACTATTGAAGCT
CCCTCACGCGATCAGGCAACGGCACACGGCATCCTGGCGCAGCTCCGAGTTCTTGGCGGCAGCTTGGGCATATCA
ACCTCGACGATTCTAGTACAAGCCGAGGCCAGAACACGACTGGCAGGCATCCTGACCGGGGCCTCAGTGGAAAGA
GAGGGGGGCGGTTTGCCGCACGTTCAGCGGGCCGCAGTCCGCGAAGCATACGCCAGAGCCTTTTCCAAAGGCATG
ATTGCAGCTGCCGTCGTCTCGGTAGTTGCCTTCGTCATTCTCGTTGGAATTCGCTGCTGCAAGACGACGCCCCGA
GGCAGTTCCACGGGATCCGACGAACCTCAGCGTATGGAAATGTAG
Gene >Ophcf2|05610
ATGACTGGTATGCAACTCCTATCACTGGTTTGCACCTGACCCTAGGACCTCTTTCCGTGCTGTCGGACTTCAATT
ACAAGCTATGACATGGCCTCGCTGACCGGAGACGGTCTACAGATAATCAAGCTCTGCATCAGAGCTTAGAACGCT
TCAATGGCCACGACGGGAGCTTCGAGGACTGTGCCGCAGAGGAGAATGAAACGCTTCTACCCTCGCCGGGTACGC
CGTATGCCGTGGAACACGATGCTTTTCAAGGCGACATACTTCCACGGGACGTTCCCAAGCGCACAACATTTTACG
ACCCGGTCGCCGAGCGCCAAATGACGCATACAGATGCCAAGCTGTTCTACCAGCGCAGCCAGATCGACTCTCGTG
GCAGAGCTCCTGGTGGGCCTTCTCGAGCTCAGCCATCCAGCCACGGCAGTCCTGTCTTGTTTTCGGGTTCTCGCT
CAGCCACAGAATACGGCGGAGGCTCTTTGACTCTTGATCACGTAAATGGCAAGCTCGACTGTCTTCCGCAAGGGG
CGCATCTCAAGAAGCTAACATGTTGGAAGTTATTCCTGACGGTGATGATCATTTCAGAAACAGCGAGCAGCCTTT
TCCGACCACAACTACCGGACGGCACGCTACCTTTCACGCAAGCGACGGCATCTTCGACGGCAAACTACGGACGGA
TTCTACAGCTGGTTTCACTAACAGCAGCCTATTCGACACAGAACCGCATATCACATCCGAGCTCAGTGCCATTTC
AAAGAACATCCAGAAGATACTGAATTTTCGACGGAAGTACCTCTCTCTATCTTTACAAGGGCCTTCGGACAACCC
TCGCGACGACCCAAGTTGGGAAATTTACCCTCCTCCTCCCGAGCCTGCGTGGGCGCAGAGCGATGTCGGTAACGG
GAAGCTGCGGGAGCGCTCCCAATCTCCGAGTGACGTAGGTCGTTCCCAAACCGCGAAGTGAGAACTCGCCCAGTC
CTAGATCCTAAGACTGACCAGCTTTGCAAGCGTAAGGGCCACAATGTGGCCGAGGAATTTACTATGGAACACCTC
TTGCCATTGCCCGACGAGGATGAGTTGGATTATAGACTCGATGACAGTGGTGTGTACCAGGTAGTGGAGTCTGAC
TTGCCCGTTATTCGAGTTCCAACCATCAGGGAGTTTTATATGGACCTGGAAGAGATTCTCGCCATCTCGTCGGAC
GGCCCAAGTAAAAGCTTTGCGTTTAGGCGGCTTCAGTATCTGGAAGCAAAATTCAATCTATACATCCTACTCAAC
GAATACCAAGAGACAGCCGACAGCAAAAAGGTGCCTCACCGAGACTTTTATAACGTTCGCAAGGTAGACACGCAC
GTTCACCACTCGGCGTGTATGAACCAAAAGCATCTGCTTCGCTTCATTAAGAGCAAGATGAAGAAGCATCCCAAC
GAGGTGGTTCTGTTTCGCGACGATAAGCATTTGACTCTAGCCGAGGTGTTTGCCAGCATTAACTTGACGGCCTAT
GACTTGAGCATCGACACTTTGGATATGCATGTAAGATGCCGATGGCGTGTTTGCCTTTAGCAACCTCTTGTTAAT
CGCTGGACGGTGCAGGCACACACCGACTCGTTTCATCGTTTTGATAAATTTAATCTCAAGTACAACCCCATCGGA
GAGTCTCGTCTTCGAACCATTTTCCTCAAGACCGACAACTTCATCCACGGACGTTACTTGGCTGAGATCACCAAG
GAAGTCATCTCGGATTTGGAGTCCAGCAAGTACCAAATGGTGGAGTGGCGCATTTCAATCTATGGCAAATCCATA
GACGAGTGGGACAAACTGGCCGCCTGGGTCGTGGACAACAAGCTTTTCTCGCACAATGTGCGGTGGCTAATTCAG
ATCCCTCGCCTGTACGACGTTTACCAAGCAAGCGGGCTCATGCAGACCTACGAGCAAATCGTCATCAACCTGTTC
CGGCCTTTGTTCGAGGTGACGAAAAACCCGTCGAGCCATCCGAAACTGCATGTTTTCCTTCAGCGGGTGATAGGG
TTTGATAGCGTCGACGATGAGAGCAAGGTCGAGAGGAGGCTGTTTAGGAAGTTCCCGGTGCCGCGTGCGTGGAAT
TCGAAACAGAACCCCCCCTACAGCTACTGGCTTTACTACCTGTTCGCGAACATGACGTCGCTCAACTTTTGGCGG
AGGCGACGGGGATTCAACACCTTCGTCCTACGGCCTCACTGTGGCGAAGCTGGCGACAGCGAGCACTTGGCAGTT
GCTGTCCTCGCCTGCCACAGTATCAGCCACGGGCTGCTGCTCCGAAAGGTGCCGCTTCTGCAGTACATCTTCTAT
CTGGAACAGATTGGCATCGCCATGTCACCACTCAGCAACAATGCTTTGTTCCTCGCGTACGAACGCAACCCTTTC
CACCAATACTTTCGGCGAGGACTCAACGTCTCGCTGTCTACGGATGACCCGCTGCAGTTCGCTTTCACTAAGGAG
GCCTTGATTGAGGAATACGCGGTTGCGGCGCAGATCTACAAGCTCAGTTCCGTCGATATGTGCGAACTTGCCAAG
AACTCTGTCAAGCAAAGTGGCTACGAGTCTTCCATTAAGCGGCAATGGCTGGGGCCGCACTACGAACTGCCCGGA
AAGCTGGGCAACGTCATGGTCAAGACAAACGTTCCTGATCGGAGGGAGGAATTCCGCTACCAAACTCTTCTCCAG
GAGCGAGACGTGTAGGTGCAAACAACGCGGCTTTTCGCCTGGCGCGAGATGGGCATAACTGACATGGCTGTAGCT
TGAGACGCTATGTGACGTACAAATCGCAGCGCGATGCGTCCGAAGACAGGATAGATGGCGTTGAATCATCGCATC
AACAGGGCGATCCTGGCTACAAGCCGCCGCCCATGACGGACGGCGCACTGGTTCAGGAGCCAGAACGACTGTCGG
AGCACATGTCAGACTTGCACCTATCGGGTATTGATCCGCAGCTATTTCCAGGTATTCTTTCGCGGGAACACCGAA
GCGGCAGCTTGCGAAGTCTGGCGGCAGCCACTACTTGGCCGGTCGACTCAAGCGAGGCGCCTGAAGATGATGACG
AAGCCTAGAGCATGGCAAGCAGTTACGTTGATGATTGAGTGATGTACACGACAACAATAGTGATAGACATTCTTA
GCAGTAGCAGCAACTCGGTTCGTGACGCGACAGCGGCGTCTGTGCGACATCTGAGATGGCCCGATCCCCTCTTCT
CGTCTGTCCTCTGTCCTCTTACCGTGGCTGCTGAGGAACAGAATCCCCTCCTCGGACTTTGAGCAAGGTATCAAT
CATCTCCGTCGCACACGCTTCGCTCGCCCGTCTATGATTGTTTGCTGGCGCTGTTTGCCGACCAGCGAAGCGAAG
AGCCTCGTAAGTCGGCAGTGAAGGCATAAGGAGCCTCCGCATGTCGCTGCCGGCCACGAAGGACGAAGAAATGCG
CGGCACTCGACATGATCGCGATGTTCTGGCCTATGCGGGCTTCATGTCCGTCGCACCGGGATGCTATCCGTCGGC
TACCGTTTCTATGCCGGCCGACAGCTTTCTACCTTCTGGCTGCTTGAAGTCAGTAAAACAAGCAAAGATTCGAAT
TATCTCCGTATCAAAGATAGAAGGACCTACCTAACTGTAGGTTAGTGCCTTCCTACTATTTGGCCAGACCGAAGC
CGGGAGGCAACAAGCCGTGAGGCGCGGCGGCAGGCCAGAAGGAAGGCACTCAGTCCGGCCTTCCACCTCCACTGA
CATATACGTACGGGGTTCTCCTGAGCTCAGAATTTTCCTCTGCCAAGTAAGTCGACTAGATAGCTCCGTCAACCC
TCGCTTCAGGCAGACCCTTCCCACGATTGGATGCGTCATCGACGTTTGTCCGTCTGGCGCTGAAGCTCTCACAGA
CAGATACAGCCCTCCGATTTTCTCATCCCGCTAAATAAGACGACGACGGCCTTGGCCTCTGTTCGACATGACAAT
ATCTCGCCTTGCTTCTACCTTTTTAGACTATCACCACCTACCAGTCTGTTCTCTTGGAGAATTACAAACCTGGCC
AATCCGATCCTGGTCTCTCTCCTCACCCTCGCTCTCACCAAGCCCGATCTTTGTCTCAACTTTCTCTCCTGGAAA
CAGCCCCTATCACCGGAGAGTGACACCTCGTCAGATCAGCCATCGACAGACACAGCGCAGTTCGCTCAAATGGCC
AACAACTCGAGCAGCGACGTCCACGGCGCATCGAGCCAGCGCTGTTCGGTCACTGGCGACGCTCCCGCAGCGGCG
AGCATCGAAGAAGCTGCGTCTGGCGAGGAGCTCAACAGCATAAGCAAGTTTGAAGTTCAGGATTCCGGACGAGAA
GAAGCCTGGCCTTCCGGTTCCGGCGGTCTTTCAAATTCAACACCTGCAATCTCCATCCACCGCTTCTGGCTGTTC
ACTTTTGGGTATGATAAACTGCTGAGGGCGTTTGTGATTCGTGGCTGACATGCCTTTGCTGGCTCGACAGCGTGT
GTCTCGGCCTGTTTCTCTCCTTGGTCGATTCGTCCATCATTGCGACCAGTCTGTATTCCATCGGCGTCGAATTTG
GATCCTTCAAGTCTGTCAACTGGGTGGCACTGGCCTACACGCTGGCCTATCTAGGTTGCGCCGTCACGTTCGCCA
GCTTGTCCGACGTGTTAGGCATGCGTCAAGCCTTCCTCCTGTCCTATGTTCTCTTTTTCGCCTTCTCACTGGCGT
GCGGGTTTGCTCGAGACCTGCCTCAGTTGATCTGCTTCCGCGCTCTTCAGGGCGTAGGCGGCTCGGGTAGGGATA
CCTTCGTCTGCCCTCTTGACAAAATGTGACCAGTCGCTCACGACTCCCCAGGACTCTACTCCTTGTCTATGATCA
TTCTGCCCGAGATATGCCCCAAGGAACGTCAGGCGCACATTGGCTCCATCATAGGAATCGTCATAGCCTGCTCCG
GCGTCATGGGTCCGGTTCTTGGGGGCGTCCTCACCCATTACGCAAGTTGGCGCTGGGTCTTCTGGATCAAGTAAG
ACCGTGTCTGCCTCAACGCTTACCGACGAAGAGGCTGACGGCAAACAGCGGGCCCGTCGGTTTAGTCTCCCTAAC
CATCTTACTTGTGGCATGGCCCAAAGAAGAGTACGTTGGCTTGATGCGACGACGCTCATGGCGCGACTTTGACGT
CGTCGGCTCTTTCCTGGTCATTGCGTCCTCCGTCTTGGTCGTCTTTGCATTCCAAAATGCTGGCGAGGCCGAGCG
CGACCATGTTTGGTGTGACGCCATCTTCATCGCTCCGTTGGTCGCCGGACTCTTCGGCTGGATGGCTCTGCTTGC
ATGGGCTTTGCGGGTTAAGACGCGATTTAGCGACTCCTTCTCGTTGGCTTTCCCACTCAGCCTCTTTCGAAACAA
GATGTACGCGGCCGGTGCTGCGTCGACGCTGCTCCTGGGTTACCCCTATCTTCTGATCATGTACTCCTTCCCGCT
CAGAGCACAGGTTGTGAGTGAGAAATCGGCGCTCGTGGCGGGACTCATGCTGCTACCGATGCTGGTGATGTCGGC
CCTGGGGAGCGCCATCAGTGGCAAGATTAACACCAAGGCTCCCCGCTTCCAGGCCACATTGCTCTTCGGAGCAAG
CTTCATGACGGTTGGCACCGCGCTGCTCACGACCGTAACTGGTTCTTGGGACGACACAAAGGCTCTCGGGTTCCT
GACCTTTTGCGGGCTTGGATTTGGCCTCTCTACGGCTGCGGCCACGAATCTCGTCACTATTGAAGCTCCCTCACG
CGATCAGGGTATGGCACGGCATCCCGATCACAGCGTCGTGCTGACTTGGTCGTGATGCAGCAACGGCACACGGCA
TCCTGGCGCAGCTCCGAGTTCTTGGCGGCAGCTTGGGCATATCAACCTCGACGATTCTAGTACAAGCCGAGGCCA
GAACACGACTGGCAGGCATCCTGACCGGGGCCTCAGTGGAAAGAGAGGGGGGCGGTTTGCCGCACGTTCAGCGGG
CCGCAGTCCGCGAAGCATACGCCAGAGCCTTTTCCAAAGGCATGATTGCAGCTGCCGTCGTCTCGGTAGTTGCCT
TCGTCATTCTCGTTGGAATTCGCTGCTGCAAGACGACGCCCCGAGGCAGTTCCACGGGATCCGACGAACCTCAGC
GTATGGAAATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail