Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05608
Gene name
Locationscaffold_06:672591..674059
Strand-
Gene length (bp)1468
Transcript length (bp)1416
Coding sequence length (bp)1416
Protein length (aa) 472

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00206 Lyase_1 Lyase 1.9E-83 15 311
PF14698 ASL_C2 Argininosuccinate lyase C-terminal 5.1E-25 373 441

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.711 0.6311 0.0986 0.0385 0.3775 0.0498 0.0124 0.1058 0.0947 0.0637

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3546
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3137
Ophiocordyceps australis map64 (Brazil) OphauB2|2309
Ophiocordyceps camponoti-floridani Ophcf2|05608 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4782
Ophiocordyceps kimflemingae Ophio5|3039
Ophiocordyceps subramaniannii Hirsu2|68

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05608
MAPNAKPEGSMLWGGRFTGGLDPLMVRYNESINFDRALYEQDIRGSIAFARANADAGIITGSEFRQIEEGLLQVL
QEWETKAFVIVPGVDEDIHTANERRLGELIGKHVAGKLHTGRSRNEQVVCDMRMWLRDELRAIERHLIDLLTVLA
DRAEGEMHLIMPGYTHLQRAQPIRWSHWLLSYGLVFADDLQRLREVIRRVNRSPLGCGALAGNPFGIDRDKMRRE
LGFDDLLWNSMGGVADRDFVTETLQWGAMLMQHISRWAEDLIVYSTTEFGFVRLADAYSTGSSLMPQKKNPDSLE
LLRGKSGRAFGQMAGFMMTQKGLPSTYNKDLQESVEPMLDQIKTVADSIQIANGVLSTLKTNGDRMRAALDPFML
ATDVADYLVRKGVPFRETHHISGRCVAKSEETGIPMSELSFEQLKAIDSRFDEDVAQVFDYDASIERRSAKGGTS
KSSVAEQIGMLRDMLKMSKET*
Coding >Ophcf2|05608
ATGGCACCCAACGCGAAGCCAGAAGGCAGTATGCTCTGGGGAGGGCGCTTTACAGGCGGCCTTGATCCCCTCATG
GTGCGGTACAACGAGAGCATCAACTTCGATCGTGCACTCTACGAGCAAGACATTCGCGGAAGCATCGCCTTCGCT
AGAGCCAACGCCGACGCCGGCATCATTACCGGATCCGAGTTCCGTCAGATCGAAGAGGGCCTACTCCAGGTTCTG
CAGGAGTGGGAGACGAAGGCCTTCGTCATCGTCCCAGGCGTCGACGAGGACATCCACACGGCCAACGAGCGCCGT
CTCGGAGAGCTCATTGGCAAACACGTCGCCGGGAAGCTTCACACGGGCCGCAGTCGCAATGAGCAGGTCGTGTGT
GACATGCGCATGTGGCTGCGCGATGAGCTGCGTGCTATTGAGCGCCATCTTATCGACCTGCTCACCGTCTTGGCG
GACCGTGCCGAGGGCGAGATGCATCTCATCATGCCCGGCTACACCCACTTGCAGCGCGCCCAGCCGATCCGCTGG
AGCCACTGGCTGCTATCGTACGGCCTGGTCTTTGCAGACGACCTGCAGCGCCTGCGCGAGGTCATTCGCCGCGTC
AACAGGAGTCCTCTAGGCTGCGGAGCCCTGGCGGGAAACCCGTTCGGCATCGACCGCGACAAGATGAGGCGCGAG
CTGGGATTCGATGACCTGCTTTGGAACTCGATGGGGGGCGTGGCCGACCGCGATTTCGTCACCGAGACGCTGCAG
TGGGGGGCCATGTTGATGCAGCACATCTCCCGCTGGGCCGAGGACCTGATTGTGTACTCGACGACCGAGTTCGGC
TTCGTCCGCCTCGCCGACGCCTACTCGACGGGAAGTTCCCTGATGCCGCAGAAGAAGAACCCGGACAGTTTGGAG
CTGCTGCGCGGCAAAAGCGGGCGCGCCTTTGGGCAGATGGCCGGCTTCATGATGACGCAAAAGGGCCTCCCCAGC
ACCTACAACAAGGACCTGCAAGAGAGCGTCGAGCCCATGCTGGACCAGATCAAGACGGTGGCCGACAGCATCCAG
ATTGCCAATGGCGTCTTATCGACGCTCAAGACCAACGGCGATCGGATGCGAGCCGCGCTGGACCCCTTTATGCTC
GCGACAGACGTGGCCGACTACCTGGTGCGCAAGGGCGTCCCCTTCCGCGAGACTCATCACATCTCGGGGCGCTGT
GTGGCCAAATCGGAGGAGACGGGCATTCCGATGAGCGAGCTGTCGTTTGAGCAGCTCAAGGCCATCGACAGCAGG
TTCGACGAGGACGTGGCCCAGGTGTTTGACTATGACGCCAGCATCGAGCGCCGGTCGGCCAAGGGCGGAACGAGC
AAGTCTAGCGTCGCGGAGCAGATCGGGATGCTGAGGGATATGTTGAAGATGAGCAAGGAAACGTGA
Transcript >Ophcf2|05608
ATGGCACCCAACGCGAAGCCAGAAGGCAGTATGCTCTGGGGAGGGCGCTTTACAGGCGGCCTTGATCCCCTCATG
GTGCGGTACAACGAGAGCATCAACTTCGATCGTGCACTCTACGAGCAAGACATTCGCGGAAGCATCGCCTTCGCT
AGAGCCAACGCCGACGCCGGCATCATTACCGGATCCGAGTTCCGTCAGATCGAAGAGGGCCTACTCCAGGTTCTG
CAGGAGTGGGAGACGAAGGCCTTCGTCATCGTCCCAGGCGTCGACGAGGACATCCACACGGCCAACGAGCGCCGT
CTCGGAGAGCTCATTGGCAAACACGTCGCCGGGAAGCTTCACACGGGCCGCAGTCGCAATGAGCAGGTCGTGTGT
GACATGCGCATGTGGCTGCGCGATGAGCTGCGTGCTATTGAGCGCCATCTTATCGACCTGCTCACCGTCTTGGCG
GACCGTGCCGAGGGCGAGATGCATCTCATCATGCCCGGCTACACCCACTTGCAGCGCGCCCAGCCGATCCGCTGG
AGCCACTGGCTGCTATCGTACGGCCTGGTCTTTGCAGACGACCTGCAGCGCCTGCGCGAGGTCATTCGCCGCGTC
AACAGGAGTCCTCTAGGCTGCGGAGCCCTGGCGGGAAACCCGTTCGGCATCGACCGCGACAAGATGAGGCGCGAG
CTGGGATTCGATGACCTGCTTTGGAACTCGATGGGGGGCGTGGCCGACCGCGATTTCGTCACCGAGACGCTGCAG
TGGGGGGCCATGTTGATGCAGCACATCTCCCGCTGGGCCGAGGACCTGATTGTGTACTCGACGACCGAGTTCGGC
TTCGTCCGCCTCGCCGACGCCTACTCGACGGGAAGTTCCCTGATGCCGCAGAAGAAGAACCCGGACAGTTTGGAG
CTGCTGCGCGGCAAAAGCGGGCGCGCCTTTGGGCAGATGGCCGGCTTCATGATGACGCAAAAGGGCCTCCCCAGC
ACCTACAACAAGGACCTGCAAGAGAGCGTCGAGCCCATGCTGGACCAGATCAAGACGGTGGCCGACAGCATCCAG
ATTGCCAATGGCGTCTTATCGACGCTCAAGACCAACGGCGATCGGATGCGAGCCGCGCTGGACCCCTTTATGCTC
GCGACAGACGTGGCCGACTACCTGGTGCGCAAGGGCGTCCCCTTCCGCGAGACTCATCACATCTCGGGGCGCTGT
GTGGCCAAATCGGAGGAGACGGGCATTCCGATGAGCGAGCTGTCGTTTGAGCAGCTCAAGGCCATCGACAGCAGG
TTCGACGAGGACGTGGCCCAGGTGTTTGACTATGACGCCAGCATCGAGCGCCGGTCGGCCAAGGGCGGAACGAGC
AAGTCTAGCGTCGCGGAGCAGATCGGGATGCTGAGGGATATGTTGAAGATGAGCAAGGAAACGTGA
Gene >Ophcf2|05608
ATGGCACCCAACGCGAAGCCAGAAGGCAGTATGCTCTGGGGAGGGCGCTTTACAGGTATGTAGCCGTATCCAGCT
ATATCGACGGCGTCTGACCATCAAATGTGCAGGCGGCCTTGATCCCCTCATGGTGCGGTACAACGAGAGCATCAA
CTTCGATCGTGCACTCTACGAGCAAGACATTCGCGGAAGCATCGCCTTCGCTAGAGCCAACGCCGACGCCGGCAT
CATTACCGGATCCGAGTTCCGTCAGATCGAAGAGGGCCTACTCCAGGTTCTGCAGGAGTGGGAGACGAAGGCCTT
CGTCATCGTCCCAGGCGTCGACGAGGACATCCACACGGCCAACGAGCGCCGTCTCGGAGAGCTCATTGGCAAACA
CGTCGCCGGGAAGCTTCACACGGGCCGCAGTCGCAATGAGCAGGTCGTGTGTGACATGCGCATGTGGCTGCGCGA
TGAGCTGCGTGCTATTGAGCGCCATCTTATCGACCTGCTCACCGTCTTGGCGGACCGTGCCGAGGGCGAGATGCA
TCTCATCATGCCCGGCTACACCCACTTGCAGCGCGCCCAGCCGATCCGCTGGAGCCACTGGCTGCTATCGTACGG
CCTGGTCTTTGCAGACGACCTGCAGCGCCTGCGCGAGGTCATTCGCCGCGTCAACAGGAGTCCTCTAGGCTGCGG
AGCCCTGGCGGGAAACCCGTTCGGCATCGACCGCGACAAGATGAGGCGCGAGCTGGGATTCGATGACCTGCTTTG
GAACTCGATGGGGGGCGTGGCCGACCGCGATTTCGTCACCGAGACGCTGCAGTGGGGGGCCATGTTGATGCAGCA
CATCTCCCGCTGGGCCGAGGACCTGATTGTGTACTCGACGACCGAGTTCGGCTTCGTCCGCCTCGCCGACGCCTA
CTCGACGGGAAGTTCCCTGATGCCGCAGAAGAAGAACCCGGACAGTTTGGAGCTGCTGCGCGGCAAAAGCGGGCG
CGCCTTTGGGCAGATGGCCGGCTTCATGATGACGCAAAAGGGCCTCCCCAGCACCTACAACAAGGACCTGCAAGA
GAGCGTCGAGCCCATGCTGGACCAGATCAAGACGGTGGCCGACAGCATCCAGATTGCCAATGGCGTCTTATCGAC
GCTCAAGACCAACGGCGATCGGATGCGAGCCGCGCTGGACCCCTTTATGCTCGCGACAGACGTGGCCGACTACCT
GGTGCGCAAGGGCGTCCCCTTCCGCGAGACTCATCACATCTCGGGGCGCTGTGTGGCCAAATCGGAGGAGACGGG
CATTCCGATGAGCGAGCTGTCGTTTGAGCAGCTCAAGGCCATCGACAGCAGGTTCGACGAGGACGTGGCCCAGGT
GTTTGACTATGACGCCAGCATCGAGCGCCGGTCGGCCAAGGGCGGAACGAGCAAGTCTAGCGTCGCGGAGCAGAT
CGGGATGCTGAGGGATATGTTGAAGATGAGCAAGGAAACGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail