Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05607
Gene name
Locationscaffold_06:668832..671923
Strand-
Gene length (bp)3091
Transcript length (bp)2937
Coding sequence length (bp)2937
Protein length (aa) 979

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01644 Chitin_synth_1 Chitin synthase 6.5E-77 291 453
PF08407 Chitin_synth_1N Chitin synthase N-terminal 2.6E-27 219 290
PF03142 Chitin_synth_2 Chitin synthase 3.6E-20 431 640

GO

GO Term Description Terminal node
GO:0006031 chitin biosynthetic process Yes
GO:0004100 chitin synthase activity Yes
GO:0016758 hexosyltransferase activity No
GO:1901071 glucosamine-containing compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0016740 transferase activity No
GO:0009058 biosynthetic process No
GO:0006022 aminoglycan metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0003824 catalytic activity No
GO:1901073 glucosamine-containing compound biosynthetic process No
GO:0008375 acetylglucosaminyltransferase activity No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0008194 UDP-glycosyltransferase activity No
GO:0006030 chitin metabolic process No
GO:0046349 amino sugar biosynthetic process No
GO:0006023 aminoglycan biosynthetic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0008150 biological_process No
GO:0006040 amino sugar metabolic process No
GO:0016757 glycosyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 639 661 22
2 674 696 22
3 711 733 22
4 752 774 22
5 784 803 19
6 884 903 19
7 918 940 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 69.34 37.89 100.78
Alive In ants, during behavior modification 28.28 15.28 41.27
Dead In ants, recently dead 45.12 24.62 65.61

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.003115 yes
Dead Fungus 0.023596 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05607
MHRPKTPPARPPDYSLSSYDDGYVDGRQTPSTGVRLLGQPPPERPSSAASTARRLYQPASSISMPPPDSTYVPFA
GRDPPWTPSSESGSRPHPPPPSATFERPDLNGSPRPGTPSSRYGGSPRRPLPPAPLFSSVSARSSVEDAAVTIPL
ETGDDGDDDDNDDDPFTSKESHGGLYASLSQETLHDEPVLQDIKIEHYGPAPNGAQERRGVRAPQMSRKEVQLIN
GELVLECKIPTILHSFLPRRSEVEFTHMRYTAVTCDPDDFVDRGYKLRQSMGRTTRETELFICITMYNEDEICFT
RTMHAVMKNIAHFCSRSRSRTWGEAGWQKIVVCIISDGRDKINPRTLDALAAMGVYQHGIAKNYVNNRAVQAHVY
EYTTQVSLDADLRFKGAEKGIVPCQIIFCLKEKNQRKLNSHRWFFNAFGKALNPNVCILLDVGTRPGGNSLYHLW
KAFDTDSNVAGACGEIKAMKGRLGSNLLNPLVASQNFEYKMSNILDKPLESVFGYITVLPGALSAYRYHALQNDE
TGHGPLSQYFKGETLHGQRADVFTANMYLAEDRILCWELVAKRGERWVLKYVKGCTGETDVPDSVPEFISQRRRW
LNGAFFAAVYSLFQCRQILATDHTIARKFLLFVEFAYQLLQLLFTYFSLANFYLTFYFVAGGLADPQNDPFGHGM
GAVIFTVLRYVCVLLVATQFVLSLGNRPQGARRLYLTSMILYGVIMLYTSFACIYIIVRQLTSSQRDTFMRMGNN
VFTNLVVSMASTIGLYFIMSFLYLEPWHMLTSSLQYFLLLPSYICTLQVYAFCNTHDVTWGTKGDNVLKTDLGTA
VGHGGQTVELDMPSEQLDIDSGYDEALRNLRDRLAVPPAPVAEAQLQEDYYKSVRTYMVVSWMMANGILAMAVSD
VYSSRGLGDNMYLRFILWSVAALAIFRAVGSTAFAVINVVNVVVEGRLRMSVKVPSWLGGLGGRLSDTVSSVGSK
LKR*
Coding >Ophcf2|05607
ATGCACCGACCAAAGACTCCGCCGGCTCGACCGCCCGACTATAGCCTTTCCAGTTACGACGACGGCTATGTGGAC
GGCCGCCAGACGCCTTCTACCGGCGTGAGACTGCTGGGACAGCCACCGCCTGAGCGTCCCTCTTCTGCCGCCTCG
ACGGCCAGACGTCTTTACCAGCCTGCCTCTTCCATCAGCATGCCGCCGCCCGACTCGACGTACGTGCCCTTTGCC
GGCCGCGATCCGCCCTGGACGCCATCGTCGGAATCCGGGTCCAGGCCTCATCCTCCTCCGCCGAGTGCGACGTTT
GAGCGGCCGGATCTCAACGGCAGTCCTCGACCCGGGACACCGTCATCTCGGTACGGCGGCAGCCCTCGACGTCCG
CTTCCGCCGGCTCCGCTGTTCTCTTCCGTCTCGGCGCGCAGCTCGGTCGAAGACGCGGCGGTGACGATACCCTTG
GAAACGGGAGACGACGGTGACGATGACGACAATGACGATGACCCTTTCACGTCCAAGGAGAGTCACGGCGGGCTG
TACGCGTCTCTATCTCAGGAAACGCTGCATGACGAGCCGGTGCTCCAGGACATCAAGATCGAGCACTACGGACCA
GCGCCCAACGGAGCCCAGGAGCGTCGCGGAGTACGAGCGCCGCAAATGTCGCGCAAGGAAGTACAGCTCATCAAC
GGCGAGCTCGTCCTCGAGTGCAAGATCCCGACGATCCTCCACAGCTTCCTCCCCCGACGAAGCGAAGTCGAATTC
ACACACATGCGATACACGGCCGTAACGTGCGACCCAGACGACTTCGTCGATCGAGGCTACAAGCTGCGACAGAGC
ATGGGACGGACAACGCGCGAGACGGAGCTGTTCATCTGTATCACCATGTACAACGAGGATGAGATTTGCTTCACG
CGGACGATGCACGCGGTCATGAAGAACATTGCGCATTTCTGCTCGCGGTCGAGATCGAGGACTTGGGGAGAGGCT
GGATGGCAAAAGATTGTCGTGTGTATCATCTCTGACGGACGCGATAAGATCAACCCTCGGACCCTGGACGCGTTG
GCTGCCATGGGCGTCTATCAGCACGGCATCGCCAAGAACTACGTCAACAACAGAGCGGTTCAGGCCCATGTTTAC
GAGTACACGACACAGGTCTCCCTCGACGCTGATCTGCGCTTCAAGGGGGCGGAGAAGGGCATCGTGCCTTGTCAG
ATCATCTTTTGTCTCAAGGAGAAGAACCAGCGGAAGCTCAACTCGCATCGTTGGTTCTTCAACGCCTTTGGAAAG
GCGCTCAACCCCAACGTCTGTATCCTCCTCGACGTCGGCACTCGTCCGGGCGGCAACTCGCTCTATCACCTCTGG
AAGGCCTTCGACACGGATTCCAACGTGGCGGGCGCCTGCGGCGAGATCAAGGCCATGAAGGGCCGTTTGGGATCC
AACCTGCTGAACCCGCTGGTGGCATCCCAGAACTTCGAGTACAAGATGAGCAACATCCTCGACAAGCCCCTCGAG
TCCGTCTTCGGCTACATCACCGTCCTACCCGGAGCCTTGAGCGCCTATCGTTACCACGCGCTGCAGAACGACGAG
ACGGGCCACGGACCTCTGAGTCAGTACTTCAAGGGCGAGACTTTGCACGGTCAGCGGGCGGATGTGTTTACGGCC
AACATGTATCTGGCCGAGGATCGTATCCTGTGCTGGGAACTCGTGGCCAAGAGGGGGGAGCGTTGGGTTCTCAAG
TACGTCAAAGGCTGTACGGGAGAGACGGACGTTCCTGACTCGGTTCCCGAATTCATCTCCCAGCGTCGAAGATGG
TTAAACGGCGCCTTCTTCGCCGCAGTCTACTCCCTCTTCCAATGCCGCCAAATCCTAGCAACCGACCACACCATC
GCCCGCAAATTCCTCCTCTTCGTCGAGTTCGCCTACCAGCTCCTACAGCTCCTCTTCACCTACTTCTCGCTCGCC
AACTTCTACCTGACCTTTTACTTCGTGGCCGGCGGGCTTGCCGATCCGCAGAACGACCCCTTTGGTCACGGGATG
GGTGCCGTCATCTTCACCGTCCTTCGCTATGTCTGCGTCTTGCTGGTCGCTACCCAGTTTGTTCTCTCTTTGGGG
AACAGGCCTCAGGGAGCGAGGAGGCTCTACCTTACCAGCATGATCTTGTACGGCGTCATCATGCTGTATACGTCG
TTTGCCTGCATCTACATCATCGTCCGACAACTCACCTCGAGCCAGCGCGACACCTTTATGCGCATGGGCAACAAC
GTCTTCACCAACCTCGTCGTCTCCATGGCATCGACGATAGGCCTCTACTTCATCATGTCCTTCCTCTACCTCGAG
CCCTGGCACATGCTCACCTCATCACTGCAATACTTCCTCCTGCTCCCCAGCTACATCTGCACCCTACAAGTCTAC
GCCTTCTGCAATACGCACGACGTCACCTGGGGCACCAAAGGCGACAACGTCCTCAAGACGGACCTCGGCACCGCT
GTCGGACACGGCGGGCAGACGGTGGAGCTCGATATGCCGAGCGAGCAGCTTGACATCGACAGCGGCTACGACGAG
GCCTTGAGGAATCTTCGTGATCGGTTGGCTGTCCCGCCCGCTCCCGTGGCCGAGGCGCAACTTCAGGAGGATTAC
TACAAGAGCGTGAGGACGTACATGGTCGTGTCGTGGATGATGGCCAACGGCATCCTCGCAATGGCCGTCTCAGAC
GTCTACAGCAGCCGAGGCCTGGGCGATAACATGTACCTCCGCTTCATCCTCTGGAGTGTGGCGGCCTTGGCCATC
TTCCGAGCCGTCGGATCGACCGCCTTTGCCGTCATCAACGTCGTCAACGTCGTGGTTGAGGGCCGACTGAGGATG
TCGGTCAAGGTTCCCTCTTGGCTGGGCGGTTTGGGCGGACGTCTGAGCGATACGGTCAGCAGCGTGGGGAGCAAG
TTGAAGCGGTAG
Transcript >Ophcf2|05607
ATGCACCGACCAAAGACTCCGCCGGCTCGACCGCCCGACTATAGCCTTTCCAGTTACGACGACGGCTATGTGGAC
GGCCGCCAGACGCCTTCTACCGGCGTGAGACTGCTGGGACAGCCACCGCCTGAGCGTCCCTCTTCTGCCGCCTCG
ACGGCCAGACGTCTTTACCAGCCTGCCTCTTCCATCAGCATGCCGCCGCCCGACTCGACGTACGTGCCCTTTGCC
GGCCGCGATCCGCCCTGGACGCCATCGTCGGAATCCGGGTCCAGGCCTCATCCTCCTCCGCCGAGTGCGACGTTT
GAGCGGCCGGATCTCAACGGCAGTCCTCGACCCGGGACACCGTCATCTCGGTACGGCGGCAGCCCTCGACGTCCG
CTTCCGCCGGCTCCGCTGTTCTCTTCCGTCTCGGCGCGCAGCTCGGTCGAAGACGCGGCGGTGACGATACCCTTG
GAAACGGGAGACGACGGTGACGATGACGACAATGACGATGACCCTTTCACGTCCAAGGAGAGTCACGGCGGGCTG
TACGCGTCTCTATCTCAGGAAACGCTGCATGACGAGCCGGTGCTCCAGGACATCAAGATCGAGCACTACGGACCA
GCGCCCAACGGAGCCCAGGAGCGTCGCGGAGTACGAGCGCCGCAAATGTCGCGCAAGGAAGTACAGCTCATCAAC
GGCGAGCTCGTCCTCGAGTGCAAGATCCCGACGATCCTCCACAGCTTCCTCCCCCGACGAAGCGAAGTCGAATTC
ACACACATGCGATACACGGCCGTAACGTGCGACCCAGACGACTTCGTCGATCGAGGCTACAAGCTGCGACAGAGC
ATGGGACGGACAACGCGCGAGACGGAGCTGTTCATCTGTATCACCATGTACAACGAGGATGAGATTTGCTTCACG
CGGACGATGCACGCGGTCATGAAGAACATTGCGCATTTCTGCTCGCGGTCGAGATCGAGGACTTGGGGAGAGGCT
GGATGGCAAAAGATTGTCGTGTGTATCATCTCTGACGGACGCGATAAGATCAACCCTCGGACCCTGGACGCGTTG
GCTGCCATGGGCGTCTATCAGCACGGCATCGCCAAGAACTACGTCAACAACAGAGCGGTTCAGGCCCATGTTTAC
GAGTACACGACACAGGTCTCCCTCGACGCTGATCTGCGCTTCAAGGGGGCGGAGAAGGGCATCGTGCCTTGTCAG
ATCATCTTTTGTCTCAAGGAGAAGAACCAGCGGAAGCTCAACTCGCATCGTTGGTTCTTCAACGCCTTTGGAAAG
GCGCTCAACCCCAACGTCTGTATCCTCCTCGACGTCGGCACTCGTCCGGGCGGCAACTCGCTCTATCACCTCTGG
AAGGCCTTCGACACGGATTCCAACGTGGCGGGCGCCTGCGGCGAGATCAAGGCCATGAAGGGCCGTTTGGGATCC
AACCTGCTGAACCCGCTGGTGGCATCCCAGAACTTCGAGTACAAGATGAGCAACATCCTCGACAAGCCCCTCGAG
TCCGTCTTCGGCTACATCACCGTCCTACCCGGAGCCTTGAGCGCCTATCGTTACCACGCGCTGCAGAACGACGAG
ACGGGCCACGGACCTCTGAGTCAGTACTTCAAGGGCGAGACTTTGCACGGTCAGCGGGCGGATGTGTTTACGGCC
AACATGTATCTGGCCGAGGATCGTATCCTGTGCTGGGAACTCGTGGCCAAGAGGGGGGAGCGTTGGGTTCTCAAG
TACGTCAAAGGCTGTACGGGAGAGACGGACGTTCCTGACTCGGTTCCCGAATTCATCTCCCAGCGTCGAAGATGG
TTAAACGGCGCCTTCTTCGCCGCAGTCTACTCCCTCTTCCAATGCCGCCAAATCCTAGCAACCGACCACACCATC
GCCCGCAAATTCCTCCTCTTCGTCGAGTTCGCCTACCAGCTCCTACAGCTCCTCTTCACCTACTTCTCGCTCGCC
AACTTCTACCTGACCTTTTACTTCGTGGCCGGCGGGCTTGCCGATCCGCAGAACGACCCCTTTGGTCACGGGATG
GGTGCCGTCATCTTCACCGTCCTTCGCTATGTCTGCGTCTTGCTGGTCGCTACCCAGTTTGTTCTCTCTTTGGGG
AACAGGCCTCAGGGAGCGAGGAGGCTCTACCTTACCAGCATGATCTTGTACGGCGTCATCATGCTGTATACGTCG
TTTGCCTGCATCTACATCATCGTCCGACAACTCACCTCGAGCCAGCGCGACACCTTTATGCGCATGGGCAACAAC
GTCTTCACCAACCTCGTCGTCTCCATGGCATCGACGATAGGCCTCTACTTCATCATGTCCTTCCTCTACCTCGAG
CCCTGGCACATGCTCACCTCATCACTGCAATACTTCCTCCTGCTCCCCAGCTACATCTGCACCCTACAAGTCTAC
GCCTTCTGCAATACGCACGACGTCACCTGGGGCACCAAAGGCGACAACGTCCTCAAGACGGACCTCGGCACCGCT
GTCGGACACGGCGGGCAGACGGTGGAGCTCGATATGCCGAGCGAGCAGCTTGACATCGACAGCGGCTACGACGAG
GCCTTGAGGAATCTTCGTGATCGGTTGGCTGTCCCGCCCGCTCCCGTGGCCGAGGCGCAACTTCAGGAGGATTAC
TACAAGAGCGTGAGGACGTACATGGTCGTGTCGTGGATGATGGCCAACGGCATCCTCGCAATGGCCGTCTCAGAC
GTCTACAGCAGCCGAGGCCTGGGCGATAACATGTACCTCCGCTTCATCCTCTGGAGTGTGGCGGCCTTGGCCATC
TTCCGAGCCGTCGGATCGACCGCCTTTGCCGTCATCAACGTCGTCAACGTCGTGGTTGAGGGCCGACTGAGGATG
TCGGTCAAGGTTCCCTCTTGGCTGGGCGGTTTGGGCGGACGTCTGAGCGATACGGTCAGCAGCGTGGGGAGCAAG
TTGAAGCGGTAG
Gene >Ophcf2|05607
ATGCACCGACCAAAGACTCCGCCGGCTCGACCGCCCGACTATAGCCTTTCCAGTTACGACGACGGCTATGTGGAC
GGCCGCCAGACGCCTTCTACCGGCGTGAGACTGCTGGGACAGCCACCGCCTGAGCGTCCCTCTTCTGCCGCGTAC
GTTTCTCGCGAGGCCCTGACCAAGATGCCCCGTCTAACGCCTCGTCGCCCGCCCAGCTCGACGGCCAGACGTCTT
TACCAGCCTGCCTCTTCCATCAGCATGCCGCCGCCCGACTCGACGTACGTGCCCTTTGCCGGCCGCGATCCGCCC
TGGACGCCATCGTCGGAATCCGGGTCCAGGCCTCATCCTCCTCCGCCGAGTGCGACGTTTGAGCGGCCGGATCTC
AACGGCAGTCCTCGACCCGGGACACCGTCATCTCGGTACGGCGGCAGCCCTCGACGTCCGCTTCCGCCGGCTCCG
CTGTTCTCTTCCGTCTCGGCGCGCAGCTCGGTCGAAGACGCGGCGGTGACGATACCCTTGGAAACGGGAGACGAC
GGTGACGATGACGACAATGACGATGACCCTTTCACGTCCAAGGAGAGTCACGGCGGGCTGTACGCGTCTCTATCT
CAGGAAACGCTGCATGACGAGCCGGTGCTCCAGGACATCAAGATCGAGCACTACGGACCAGCGCCCAACGGAGCC
CAGGAGCGTCGCGGAGTACGAGCGCCGCAAATGTCGCGCAAGGAAGTACAGCTCATCAACGGCGAGCTCGTCCTC
GAGTGCAAGATCCCGACGATCCTCCACAGCTTCCTCCCCCGACGAAGCGAAGTCGAATTCACACACATGCGATAC
ACGGCCGTAACGTGCGACCCAGACGACTTCGTCGATCGAGGCTACAAGCTGCGACAGAGCATGGGACGGACAACG
CGCGAGACGGAGCTGTTCATCTGTATCACCATGTACAACGAGGATGAGATTTGCTTCACGCGGACGATGCACGCG
GTCATGAAGAACATTGCGCATTTCTGCTCGCGGTCGAGATCGAGGACTTGGGGAGAGGCTGGATGGCAAAAGATT
GTCGTGTGTATCATCTCTGACGGACGCGATAAGATCAACCCTCGGACCCTGGACGCGTTGGCTGCCATGGGCGTC
TATCAGCACGGCATCGCCAAGAACTACGTCAACAACAGAGCGGTTCAGGCCCATGTTTACGAGTACACGACACAG
GTCTCCCTCGACGCTGATCTGCGCTTCAAGGGGGCGGAGAAGGGCATCGTGCCTTGTCAGATCATCTTTTGTCTC
AAGGAGAAGAACCAGCGGAAGCTCAACTCGCATCGTTGGTTCTTCAACGCCTTTGGAAAGGCGCTCAACCCCAAC
GTCTGTATCCTCCTCGACGTCGGCACTCGTCCGGGCGGCAACTCGCTCTATCACCTCTGGAAGGCCTTCGACACG
GATTCCAACGTGGCGGGCGCCTGCGGCGAGATCAAGGCCATGAAGGGCCGTTTGGGATCCAACCTGCTGAACCCG
CTGGTGGCATCCCAGAACTTCGAGTACAAGATGAGCAACATCCTCGACAAGCCCCTCGAGTCCGTCTTCGGCTAC
ATCACCGTCCTACCCGGAGCCTTGAGCGCCTATCGTTACCACGCGCTGCAGAACGACGAGACGGGCCACGGACCT
CTGAGTCAGTACTTCAAGGGCGAGACTTTGCACGGTCAGCGGGCGGATGTGTTTACGGCCAACATGTATCTGGCC
GAGGATCGTATCCTGTGCTGGGAACTCGTGGCCAAGAGGGGGGAGCGTTGGGTTCTCAAGTACGTCAAAGGCTGT
ACGGGAGAGACGGACGTTCCTGGTGAGTTCTCGGCTCGAATCCCCCTTCCCTACTCCTAAAGACATCATCATCAT
CATCATCATCATCATCATCATCATCTCTAACCATGCGTCAGACTCGGTTCCCGAATTCATCTCCCAGCGTCGAAG
ATGGTTAAACGGCGCCTTCTTCGCCGCAGTCTACTCCCTCTTCCAATGCCGCCAAATCCTAGCAACCGACCACAC
CATCGCCCGCAAATTCCTCCTCTTCGTCGAGTTCGCCTACCAGCTCCTACAGCTCCTCTTCACCTACTTCTCGCT
CGCCAACTTCTACCTGACCTTTTACTTCGTGGCCGGCGGGCTTGCCGATCCGCAGAACGACCCCTTTGGTCACGG
GATGGGTGCCGTCATCTTCACCGTCCTTCGCTATGTCTGCGTCTTGCTGGTCGCTACCCAGTTTGTTCTCTCTTT
GGGGAACAGGCCTCAGGGAGCGAGGAGGCTCTACCTTACCAGCATGATCTTGTACGGCGTCATCATGCTGTATAC
GTCGTTTGCCTGCATCTACATCATCGTCCGACAACTCACCTCGAGCCAGCGCGACACCTTTATGCGCATGGGCAA
CAACGTCTTCACCAACCTCGTCGTCTCCATGGCATCGACGATAGGCCTCTACTTCATCATGTCCTTCCTCTACCT
CGAGCCCTGGCACATGCTCACCTCATCACTGCAATACTTCCTCCTGCTCCCCAGCTACATCTGCACCCTACAAGT
CTACGCCTTCTGCAATACGCACGACGTCACCTGGGGCACCAAAGGCGACAACGTCCTCAAGACGGACCTCGGCAC
CGCTGTCGGACACGGCGGGCAGACGGTGGAGCTCGATATGCCGAGCGAGCAGCTTGACATCGACAGCGGCTACGA
CGAGGCCTTGAGGAATCTTCGTGATCGGTTGGCTGTCCCGCCCGCTCCCGTGGCCGAGGCGCAACTTCAGGAGGA
TTACTACAAGAGCGTGAGGACGTACATGGTCGTGTCGTGGATGATGGCCAACGGCATCCTCGCAATGGCCGTCTC
AGACGTCTACAGCAGCCGAGGCCTGGGCGATAACATGTACCTCCGCTTCATCCTCTGGAGTGTGGCGGCCTTGGC
CATCTTCCGAGCCGTCGGATCGACCGCCTTTGCCGTCATCAACGTCGTCAACGTCGTGGTTGAGGGCCGACTGAG
GATGTCGGTCAAGGTTCCCTCTTGGCTGGGCGGTTTGGGCGGACGTCTGAGCGATACGGTCAGCAGCGTGGGGAG
CAAGTTGAAGCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail