Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05607
Gene name
Locationscaffold_06:668832..671923
Strand-
Gene length (bp)3091
Transcript length (bp)2937
Coding sequence length (bp)2937
Protein length (aa) 979

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01644 Chitin_synth_1 Chitin synthase 6.5E-77 291 453
PF08407 Chitin_synth_1N Chitin synthase N-terminal 2.6E-27 219 290
PF03142 Chitin_synth_2 Chitin synthase 3.6E-20 431 640

GO

GO Term Description Terminal node
GO:0006031 chitin biosynthetic process Yes
GO:0004100 chitin synthase activity Yes
GO:0016758 hexosyltransferase activity No
GO:1901071 glucosamine-containing compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0016740 transferase activity No
GO:0009058 biosynthetic process No
GO:0006022 aminoglycan metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0003824 catalytic activity No
GO:1901073 glucosamine-containing compound biosynthetic process No
GO:0008375 acetylglucosaminyltransferase activity No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0008194 UDP-glycosyltransferase activity No
GO:0006030 chitin metabolic process No
GO:0046349 amino sugar biosynthetic process No
GO:0006023 aminoglycan biosynthetic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0008150 biological_process No
GO:0006040 amino sugar metabolic process No
GO:0016757 glycosyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 639 661 22
2 674 696 22
3 711 733 22
4 752 774 22
5 784 803 19
6 884 903 19
7 918 940 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05607
MHRPKTPPARPPDYSLSSYDDGYVDGRQTPSTGVRLLGQPPPERPSSAASTARRLYQPASSISMPPPDSTYVPFA
GRDPPWTPSSESGSRPHPPPPSATFERPDLNGSPRPGTPSSRYGGSPRRPLPPAPLFSSVSARSSVEDAAVTIPL
ETGDDGDDDDNDDDPFTSKESHGGLYASLSQETLHDEPVLQDIKIEHYGPAPNGAQERRGVRAPQMSRKEVQLIN
GELVLECKIPTILHSFLPRRSEVEFTHMRYTAVTCDPDDFVDRGYKLRQSMGRTTRETELFICITMYNEDEICFT
RTMHAVMKNIAHFCSRSRSRTWGEAGWQKIVVCIISDGRDKINPRTLDALAAMGVYQHGIAKNYVNNRAVQAHVY
EYTTQVSLDADLRFKGAEKGIVPCQIIFCLKEKNQRKLNSHRWFFNAFGKALNPNVCILLDVGTRPGGNSLYHLW
KAFDTDSNVAGACGEIKAMKGRLGSNLLNPLVASQNFEYKMSNILDKPLESVFGYITVLPGALSAYRYHALQNDE
TGHGPLSQYFKGETLHGQRADVFTANMYLAEDRILCWELVAKRGERWVLKYVKGCTGETDVPDSVPEFISQRRRW
LNGAFFAAVYSLFQCRQILATDHTIARKFLLFVEFAYQLLQLLFTYFSLANFYLTFYFVAGGLADPQNDPFGHGM
GAVIFTVLRYVCVLLVATQFVLSLGNRPQGARRLYLTSMILYGVIMLYTSFACIYIIVRQLTSSQRDTFMRMGNN
VFTNLVVSMASTIGLYFIMSFLYLEPWHMLTSSLQYFLLLPSYICTLQVYAFCNTHDVTWGTKGDNVLKTDLGTA
VGHGGQTVELDMPSEQLDIDSGYDEALRNLRDRLAVPPAPVAEAQLQEDYYKSVRTYMVVSWMMANGILAMAVSD
VYSSRGLGDNMYLRFILWSVAALAIFRAVGSTAFAVINVVNVVVEGRLRMSVKVPSWLGGLGGRLSDTVSSVGSK
LKR*
Coding >Ophcf2|05607
ATGCACCGACCAAAGACTCCGCCGGCTCGACCGCCCGACTATAGCCTTTCCAGTTACGACGACGGCTATGTGGAC
GGCCGCCAGACGCCTTCTACCGGCGTGAGACTGCTGGGACAGCCACCGCCTGAGCGTCCCTCTTCTGCCGCCTCG
ACGGCCAGACGTCTTTACCAGCCTGCCTCTTCCATCAGCATGCCGCCGCCCGACTCGACGTACGTGCCCTTTGCC
GGCCGCGATCCGCCCTGGACGCCATCGTCGGAATCCGGGTCCAGGCCTCATCCTCCTCCGCCGAGTGCGACGTTT
GAGCGGCCGGATCTCAACGGCAGTCCTCGACCCGGGACACCGTCATCTCGGTACGGCGGCAGCCCTCGACGTCCG
CTTCCGCCGGCTCCGCTGTTCTCTTCCGTCTCGGCGCGCAGCTCGGTCGAAGACGCGGCGGTGACGATACCCTTG
GAAACGGGAGACGACGGTGACGATGACGACAATGACGATGACCCTTTCACGTCCAAGGAGAGTCACGGCGGGCTG
TACGCGTCTCTATCTCAGGAAACGCTGCATGACGAGCCGGTGCTCCAGGACATCAAGATCGAGCACTACGGACCA
GCGCCCAACGGAGCCCAGGAGCGTCGCGGAGTACGAGCGCCGCAAATGTCGCGCAAGGAAGTACAGCTCATCAAC
GGCGAGCTCGTCCTCGAGTGCAAGATCCCGACGATCCTCCACAGCTTCCTCCCCCGACGAAGCGAAGTCGAATTC
ACACACATGCGATACACGGCCGTAACGTGCGACCCAGACGACTTCGTCGATCGAGGCTACAAGCTGCGACAGAGC
ATGGGACGGACAACGCGCGAGACGGAGCTGTTCATCTGTATCACCATGTACAACGAGGATGAGATTTGCTTCACG
CGGACGATGCACGCGGTCATGAAGAACATTGCGCATTTCTGCTCGCGGTCGAGATCGAGGACTTGGGGAGAGGCT
GGATGGCAAAAGATTGTCGTGTGTATCATCTCTGACGGACGCGATAAGATCAACCCTCGGACCCTGGACGCGTTG
GCTGCCATGGGCGTCTATCAGCACGGCATCGCCAAGAACTACGTCAACAACAGAGCGGTTCAGGCCCATGTTTAC
GAGTACACGACACAGGTCTCCCTCGACGCTGATCTGCGCTTCAAGGGGGCGGAGAAGGGCATCGTGCCTTGTCAG
ATCATCTTTTGTCTCAAGGAGAAGAACCAGCGGAAGCTCAACTCGCATCGTTGGTTCTTCAACGCCTTTGGAAAG
GCGCTCAACCCCAACGTCTGTATCCTCCTCGACGTCGGCACTCGTCCGGGCGGCAACTCGCTCTATCACCTCTGG
AAGGCCTTCGACACGGATTCCAACGTGGCGGGCGCCTGCGGCGAGATCAAGGCCATGAAGGGCCGTTTGGGATCC
AACCTGCTGAACCCGCTGGTGGCATCCCAGAACTTCGAGTACAAGATGAGCAACATCCTCGACAAGCCCCTCGAG
TCCGTCTTCGGCTACATCACCGTCCTACCCGGAGCCTTGAGCGCCTATCGTTACCACGCGCTGCAGAACGACGAG
ACGGGCCACGGACCTCTGAGTCAGTACTTCAAGGGCGAGACTTTGCACGGTCAGCGGGCGGATGTGTTTACGGCC
AACATGTATCTGGCCGAGGATCGTATCCTGTGCTGGGAACTCGTGGCCAAGAGGGGGGAGCGTTGGGTTCTCAAG
TACGTCAAAGGCTGTACGGGAGAGACGGACGTTCCTGACTCGGTTCCCGAATTCATCTCCCAGCGTCGAAGATGG
TTAAACGGCGCCTTCTTCGCCGCAGTCTACTCCCTCTTCCAATGCCGCCAAATCCTAGCAACCGACCACACCATC
GCCCGCAAATTCCTCCTCTTCGTCGAGTTCGCCTACCAGCTCCTACAGCTCCTCTTCACCTACTTCTCGCTCGCC
AACTTCTACCTGACCTTTTACTTCGTGGCCGGCGGGCTTGCCGATCCGCAGAACGACCCCTTTGGTCACGGGATG
GGTGCCGTCATCTTCACCGTCCTTCGCTATGTCTGCGTCTTGCTGGTCGCTACCCAGTTTGTTCTCTCTTTGGGG
AACAGGCCTCAGGGAGCGAGGAGGCTCTACCTTACCAGCATGATCTTGTACGGCGTCATCATGCTGTATACGTCG
TTTGCCTGCATCTACATCATCGTCCGACAACTCACCTCGAGCCAGCGCGACACCTTTATGCGCATGGGCAACAAC
GTCTTCACCAACCTCGTCGTCTCCATGGCATCGACGATAGGCCTCTACTTCATCATGTCCTTCCTCTACCTCGAG
CCCTGGCACATGCTCACCTCATCACTGCAATACTTCCTCCTGCTCCCCAGCTACATCTGCACCCTACAAGTCTAC
GCCTTCTGCAATACGCACGACGTCACCTGGGGCACCAAAGGCGACAACGTCCTCAAGACGGACCTCGGCACCGCT
GTCGGACACGGCGGGCAGACGGTGGAGCTCGATATGCCGAGCGAGCAGCTTGACATCGACAGCGGCTACGACGAG
GCCTTGAGGAATCTTCGTGATCGGTTGGCTGTCCCGCCCGCTCCCGTGGCCGAGGCGCAACTTCAGGAGGATTAC
TACAAGAGCGTGAGGACGTACATGGTCGTGTCGTGGATGATGGCCAACGGCATCCTCGCAATGGCCGTCTCAGAC
GTCTACAGCAGCCGAGGCCTGGGCGATAACATGTACCTCCGCTTCATCCTCTGGAGTGTGGCGGCCTTGGCCATC
TTCCGAGCCGTCGGATCGACCGCCTTTGCCGTCATCAACGTCGTCAACGTCGTGGTTGAGGGCCGACTGAGGATG
TCGGTCAAGGTTCCCTCTTGGCTGGGCGGTTTGGGCGGACGTCTGAGCGATACGGTCAGCAGCGTGGGGAGCAAG
TTGAAGCGGTAG
Transcript >Ophcf2|05607
ATGCACCGACCAAAGACTCCGCCGGCTCGACCGCCCGACTATAGCCTTTCCAGTTACGACGACGGCTATGTGGAC
GGCCGCCAGACGCCTTCTACCGGCGTGAGACTGCTGGGACAGCCACCGCCTGAGCGTCCCTCTTCTGCCGCCTCG
ACGGCCAGACGTCTTTACCAGCCTGCCTCTTCCATCAGCATGCCGCCGCCCGACTCGACGTACGTGCCCTTTGCC
GGCCGCGATCCGCCCTGGACGCCATCGTCGGAATCCGGGTCCAGGCCTCATCCTCCTCCGCCGAGTGCGACGTTT
GAGCGGCCGGATCTCAACGGCAGTCCTCGACCCGGGACACCGTCATCTCGGTACGGCGGCAGCCCTCGACGTCCG
CTTCCGCCGGCTCCGCTGTTCTCTTCCGTCTCGGCGCGCAGCTCGGTCGAAGACGCGGCGGTGACGATACCCTTG
GAAACGGGAGACGACGGTGACGATGACGACAATGACGATGACCCTTTCACGTCCAAGGAGAGTCACGGCGGGCTG
TACGCGTCTCTATCTCAGGAAACGCTGCATGACGAGCCGGTGCTCCAGGACATCAAGATCGAGCACTACGGACCA
GCGCCCAACGGAGCCCAGGAGCGTCGCGGAGTACGAGCGCCGCAAATGTCGCGCAAGGAAGTACAGCTCATCAAC
GGCGAGCTCGTCCTCGAGTGCAAGATCCCGACGATCCTCCACAGCTTCCTCCCCCGACGAAGCGAAGTCGAATTC
ACACACATGCGATACACGGCCGTAACGTGCGACCCAGACGACTTCGTCGATCGAGGCTACAAGCTGCGACAGAGC
ATGGGACGGACAACGCGCGAGACGGAGCTGTTCATCTGTATCACCATGTACAACGAGGATGAGATTTGCTTCACG
CGGACGATGCACGCGGTCATGAAGAACATTGCGCATTTCTGCTCGCGGTCGAGATCGAGGACTTGGGGAGAGGCT
GGATGGCAAAAGATTGTCGTGTGTATCATCTCTGACGGACGCGATAAGATCAACCCTCGGACCCTGGACGCGTTG
GCTGCCATGGGCGTCTATCAGCACGGCATCGCCAAGAACTACGTCAACAACAGAGCGGTTCAGGCCCATGTTTAC
GAGTACACGACACAGGTCTCCCTCGACGCTGATCTGCGCTTCAAGGGGGCGGAGAAGGGCATCGTGCCTTGTCAG
ATCATCTTTTGTCTCAAGGAGAAGAACCAGCGGAAGCTCAACTCGCATCGTTGGTTCTTCAACGCCTTTGGAAAG
GCGCTCAACCCCAACGTCTGTATCCTCCTCGACGTCGGCACTCGTCCGGGCGGCAACTCGCTCTATCACCTCTGG
AAGGCCTTCGACACGGATTCCAACGTGGCGGGCGCCTGCGGCGAGATCAAGGCCATGAAGGGCCGTTTGGGATCC
AACCTGCTGAACCCGCTGGTGGCATCCCAGAACTTCGAGTACAAGATGAGCAACATCCTCGACAAGCCCCTCGAG
TCCGTCTTCGGCTACATCACCGTCCTACCCGGAGCCTTGAGCGCCTATCGTTACCACGCGCTGCAGAACGACGAG
ACGGGCCACGGACCTCTGAGTCAGTACTTCAAGGGCGAGACTTTGCACGGTCAGCGGGCGGATGTGTTTACGGCC
AACATGTATCTGGCCGAGGATCGTATCCTGTGCTGGGAACTCGTGGCCAAGAGGGGGGAGCGTTGGGTTCTCAAG
TACGTCAAAGGCTGTACGGGAGAGACGGACGTTCCTGACTCGGTTCCCGAATTCATCTCCCAGCGTCGAAGATGG
TTAAACGGCGCCTTCTTCGCCGCAGTCTACTCCCTCTTCCAATGCCGCCAAATCCTAGCAACCGACCACACCATC
GCCCGCAAATTCCTCCTCTTCGTCGAGTTCGCCTACCAGCTCCTACAGCTCCTCTTCACCTACTTCTCGCTCGCC
AACTTCTACCTGACCTTTTACTTCGTGGCCGGCGGGCTTGCCGATCCGCAGAACGACCCCTTTGGTCACGGGATG
GGTGCCGTCATCTTCACCGTCCTTCGCTATGTCTGCGTCTTGCTGGTCGCTACCCAGTTTGTTCTCTCTTTGGGG
AACAGGCCTCAGGGAGCGAGGAGGCTCTACCTTACCAGCATGATCTTGTACGGCGTCATCATGCTGTATACGTCG
TTTGCCTGCATCTACATCATCGTCCGACAACTCACCTCGAGCCAGCGCGACACCTTTATGCGCATGGGCAACAAC
GTCTTCACCAACCTCGTCGTCTCCATGGCATCGACGATAGGCCTCTACTTCATCATGTCCTTCCTCTACCTCGAG
CCCTGGCACATGCTCACCTCATCACTGCAATACTTCCTCCTGCTCCCCAGCTACATCTGCACCCTACAAGTCTAC
GCCTTCTGCAATACGCACGACGTCACCTGGGGCACCAAAGGCGACAACGTCCTCAAGACGGACCTCGGCACCGCT
GTCGGACACGGCGGGCAGACGGTGGAGCTCGATATGCCGAGCGAGCAGCTTGACATCGACAGCGGCTACGACGAG
GCCTTGAGGAATCTTCGTGATCGGTTGGCTGTCCCGCCCGCTCCCGTGGCCGAGGCGCAACTTCAGGAGGATTAC
TACAAGAGCGTGAGGACGTACATGGTCGTGTCGTGGATGATGGCCAACGGCATCCTCGCAATGGCCGTCTCAGAC
GTCTACAGCAGCCGAGGCCTGGGCGATAACATGTACCTCCGCTTCATCCTCTGGAGTGTGGCGGCCTTGGCCATC
TTCCGAGCCGTCGGATCGACCGCCTTTGCCGTCATCAACGTCGTCAACGTCGTGGTTGAGGGCCGACTGAGGATG
TCGGTCAAGGTTCCCTCTTGGCTGGGCGGTTTGGGCGGACGTCTGAGCGATACGGTCAGCAGCGTGGGGAGCAAG
TTGAAGCGGTAG
Gene >Ophcf2|05607
ATGCACCGACCAAAGACTCCGCCGGCTCGACCGCCCGACTATAGCCTTTCCAGTTACGACGACGGCTATGTGGAC
GGCCGCCAGACGCCTTCTACCGGCGTGAGACTGCTGGGACAGCCACCGCCTGAGCGTCCCTCTTCTGCCGCGTAC
GTTTCTCGCGAGGCCCTGACCAAGATGCCCCGTCTAACGCCTCGTCGCCCGCCCAGCTCGACGGCCAGACGTCTT
TACCAGCCTGCCTCTTCCATCAGCATGCCGCCGCCCGACTCGACGTACGTGCCCTTTGCCGGCCGCGATCCGCCC
TGGACGCCATCGTCGGAATCCGGGTCCAGGCCTCATCCTCCTCCGCCGAGTGCGACGTTTGAGCGGCCGGATCTC
AACGGCAGTCCTCGACCCGGGACACCGTCATCTCGGTACGGCGGCAGCCCTCGACGTCCGCTTCCGCCGGCTCCG
CTGTTCTCTTCCGTCTCGGCGCGCAGCTCGGTCGAAGACGCGGCGGTGACGATACCCTTGGAAACGGGAGACGAC
GGTGACGATGACGACAATGACGATGACCCTTTCACGTCCAAGGAGAGTCACGGCGGGCTGTACGCGTCTCTATCT
CAGGAAACGCTGCATGACGAGCCGGTGCTCCAGGACATCAAGATCGAGCACTACGGACCAGCGCCCAACGGAGCC
CAGGAGCGTCGCGGAGTACGAGCGCCGCAAATGTCGCGCAAGGAAGTACAGCTCATCAACGGCGAGCTCGTCCTC
GAGTGCAAGATCCCGACGATCCTCCACAGCTTCCTCCCCCGACGAAGCGAAGTCGAATTCACACACATGCGATAC
ACGGCCGTAACGTGCGACCCAGACGACTTCGTCGATCGAGGCTACAAGCTGCGACAGAGCATGGGACGGACAACG
CGCGAGACGGAGCTGTTCATCTGTATCACCATGTACAACGAGGATGAGATTTGCTTCACGCGGACGATGCACGCG
GTCATGAAGAACATTGCGCATTTCTGCTCGCGGTCGAGATCGAGGACTTGGGGAGAGGCTGGATGGCAAAAGATT
GTCGTGTGTATCATCTCTGACGGACGCGATAAGATCAACCCTCGGACCCTGGACGCGTTGGCTGCCATGGGCGTC
TATCAGCACGGCATCGCCAAGAACTACGTCAACAACAGAGCGGTTCAGGCCCATGTTTACGAGTACACGACACAG
GTCTCCCTCGACGCTGATCTGCGCTTCAAGGGGGCGGAGAAGGGCATCGTGCCTTGTCAGATCATCTTTTGTCTC
AAGGAGAAGAACCAGCGGAAGCTCAACTCGCATCGTTGGTTCTTCAACGCCTTTGGAAAGGCGCTCAACCCCAAC
GTCTGTATCCTCCTCGACGTCGGCACTCGTCCGGGCGGCAACTCGCTCTATCACCTCTGGAAGGCCTTCGACACG
GATTCCAACGTGGCGGGCGCCTGCGGCGAGATCAAGGCCATGAAGGGCCGTTTGGGATCCAACCTGCTGAACCCG
CTGGTGGCATCCCAGAACTTCGAGTACAAGATGAGCAACATCCTCGACAAGCCCCTCGAGTCCGTCTTCGGCTAC
ATCACCGTCCTACCCGGAGCCTTGAGCGCCTATCGTTACCACGCGCTGCAGAACGACGAGACGGGCCACGGACCT
CTGAGTCAGTACTTCAAGGGCGAGACTTTGCACGGTCAGCGGGCGGATGTGTTTACGGCCAACATGTATCTGGCC
GAGGATCGTATCCTGTGCTGGGAACTCGTGGCCAAGAGGGGGGAGCGTTGGGTTCTCAAGTACGTCAAAGGCTGT
ACGGGAGAGACGGACGTTCCTGGTGAGTTCTCGGCTCGAATCCCCCTTCCCTACTCCTAAAGACATCATCATCAT
CATCATCATCATCATCATCATCATCTCTAACCATGCGTCAGACTCGGTTCCCGAATTCATCTCCCAGCGTCGAAG
ATGGTTAAACGGCGCCTTCTTCGCCGCAGTCTACTCCCTCTTCCAATGCCGCCAAATCCTAGCAACCGACCACAC
CATCGCCCGCAAATTCCTCCTCTTCGTCGAGTTCGCCTACCAGCTCCTACAGCTCCTCTTCACCTACTTCTCGCT
CGCCAACTTCTACCTGACCTTTTACTTCGTGGCCGGCGGGCTTGCCGATCCGCAGAACGACCCCTTTGGTCACGG
GATGGGTGCCGTCATCTTCACCGTCCTTCGCTATGTCTGCGTCTTGCTGGTCGCTACCCAGTTTGTTCTCTCTTT
GGGGAACAGGCCTCAGGGAGCGAGGAGGCTCTACCTTACCAGCATGATCTTGTACGGCGTCATCATGCTGTATAC
GTCGTTTGCCTGCATCTACATCATCGTCCGACAACTCACCTCGAGCCAGCGCGACACCTTTATGCGCATGGGCAA
CAACGTCTTCACCAACCTCGTCGTCTCCATGGCATCGACGATAGGCCTCTACTTCATCATGTCCTTCCTCTACCT
CGAGCCCTGGCACATGCTCACCTCATCACTGCAATACTTCCTCCTGCTCCCCAGCTACATCTGCACCCTACAAGT
CTACGCCTTCTGCAATACGCACGACGTCACCTGGGGCACCAAAGGCGACAACGTCCTCAAGACGGACCTCGGCAC
CGCTGTCGGACACGGCGGGCAGACGGTGGAGCTCGATATGCCGAGCGAGCAGCTTGACATCGACAGCGGCTACGA
CGAGGCCTTGAGGAATCTTCGTGATCGGTTGGCTGTCCCGCCCGCTCCCGTGGCCGAGGCGCAACTTCAGGAGGA
TTACTACAAGAGCGTGAGGACGTACATGGTCGTGTCGTGGATGATGGCCAACGGCATCCTCGCAATGGCCGTCTC
AGACGTCTACAGCAGCCGAGGCCTGGGCGATAACATGTACCTCCGCTTCATCCTCTGGAGTGTGGCGGCCTTGGC
CATCTTCCGAGCCGTCGGATCGACCGCCTTTGCCGTCATCAACGTCGTCAACGTCGTGGTTGAGGGCCGACTGAG
GATGTCGGTCAAGGTTCCCTCTTGGCTGGGCGGTTTGGGCGGACGTCTGAGCGATACGGTCAGCAGCGTGGGGAG
CAAGTTGAAGCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail