Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05606
Gene name
Locationscaffold_06:663760..668547
Strand+
Gene length (bp)4787
Transcript length (bp)4596
Coding sequence length (bp)4596
Protein length (aa) 1532

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01077 NIR_SIR Nitrite and sulphite reductase 4Fe-4S domain 2.7E-48 1116 1282
PF03460 NIR_SIR_ferr Nitrite/Sulfite reductase ferredoxin-like half domain 3.4E-13 1021 1080
PF03460 NIR_SIR_ferr Nitrite/Sulfite reductase ferredoxin-like half domain 2.4E-15 1300 1369
PF00258 Flavodoxin_1 Flavodoxin 1.9E-27 793 935

GO

GO Term Description Terminal node
GO:0051536 iron-sulfur cluster binding Yes
GO:0020037 heme binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0010181 FMN binding Yes
GO:0097159 organic cyclic compound binding No
GO:0000166 nucleotide binding No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0043167 ion binding No
GO:0051540 metal cluster binding No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:0046906 tetrapyrrole binding No
GO:1901363 heterocyclic compound binding No
GO:0097367 carbohydrate derivative binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6625 0.3274 0.1614 0.102 0.2201 0.0668 0.0571 0.1224 0.0976 0.0626

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 127.76 58.79 196.73
Alive In ants, during behavior modification 52.31 25.05 79.56
Dead In ants, recently dead 79.97 38.15 121.79

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.029084 yes
Dead Fungus 0.043384 yes

Orthologs

Orthofinder run ID4
Orthogroup5726
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7116
Ophiocordyceps australis map64 (Brazil) OphauB2|5504
Ophiocordyceps camponoti-floridani Ophcf2|05606 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4780
Ophiocordyceps kimflemingae Ophio5|6448
Ophiocordyceps subramaniannii Hirsu2|8976

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05606
MEASPSIRKPEEAVARIAYLASDVVVAVQSSLATPSEFSEHLQRYAGRRDRSLVATTADAVPDILPVRQNTDPLL
SVFTPIRSAKLVSVTAPSSILLPAVSHLYRLANYPIVLHISLLPRNRSDYSAITSIRNSGWAFLQSETLQEAQDM
AITAHALAIRTGKGVIHFFSPASSADDEPVGAEDAAVVREILDMESVRRFQSGGIQASGIYTHDGHTAISSDHPE
TTLASTGSTKNGNLQAFALGERPKGTSVATSVKSSEHSESSTPVAPSSVATTVEATPSQILSEDIYTCVKRIWSQ
IQLALGRQYNAFEYYGPTDAENCLFIFGSNTRLFRDTVSNAKPDDVFAKAGIVVPRLYRPWIGSKLSGALPRSVK
RVAVLEQMHRATTKWGPLLIDILSSVHRGPGGVQTIVGYQLGCLAPGTIVQALRGVVQNLLTEKPVQNLEVGVKD
APQLPSDPKPPQLETAYSKILDQLFGPRAYIANAIDAANPGVSPEVWTSPEFGFGSLLARKDARAKFVAEVKDVS
RSGSFASEEPKNLLARWALSAGSENPPTDLADQVITCLESDGSSAAQSLLSRRRHFYQESLWLMGSDAWAYDLGN
SGVHHVLASGENINMLIIDSTPYSSRGAADADRRKKDIGLYAMNFGNAYVASTAVYSSYTQVLQAMLEAAKFQGP
SVVLAYLPYFGETDSPLTVLQETKRAVEAGYWPLYRWNPNNEQDSEPSFSLDSELIKQELKTFLARDNQLTQLMR
KEPKFAASLAQDFGTEVRARQKRKARDAYNQLLEGLLGAPLTILFASDNGNGASLAKRLGNRGRARGLKTVVMAM
EDYLVEDLGREENVVFITSTAGQGEFPQNGLPFWEAIRGKTDLDLATVNFSVFALGDSHYWPRKEDKIFYNKPGK
DLDRLLSNLGGVRLCDIGLGDDQDPDGYQTGYQEWEPKLWQALGVDKVDGLPEEPPPITNEDIKLASNYLRGTIV
EGLEDSSTGAISAADQQLTKFHGTYMQDDRDVRDERKAQGLEPAYSFMIRCRLPGGVATPQQWLQMDDISTSLGN
ETMKLTTRQTFQFHGVVKGRLKPAMQAINRALMTTIAACGDVNRNVMCSSLPTQSHYHKQVHACSQKISHHLLPS
TSAYHEIWLTNADDGKKIQVAGDALQDFEPLYGPTYLPRKFKITIAVPPHNDTDVYAHDIGLIAIAGSDGQLEGF
NVLAGGGMGATHNNKKTYPQTGRMMGFCATDEIHVACEKIMLVQRDHGDRKNRKHARLKYTIDDMGLDVFRAKVE
ALWGRQFEPERPFRFTSNVDTFGWQRDETGLNHFGLFIENGRIEDRPEFRMKTGLREVAKLHKGEFRLTGNQHLI
LSNVADDDLPAMKRLLAEYGLDNVQFSGLRLSSSACVAFPTCGLAMAESERYLPELISKLESCLEDNGLRQESIV
MRMTGCPNGCARPWLAEVAFVGKAYGAYNMYLGGGYHGQRLNKLYRSSIKEDEILAIMKPLLKRYALERLPDERF
GDFCIRVGLVHATRDGRDFHDDVAEEESGEE*
Coding >Ophcf2|05606
ATGGAAGCATCTCCGTCGATCCGCAAGCCGGAAGAGGCCGTGGCCCGGATCGCCTACCTTGCCAGCGATGTCGTC
GTTGCGGTACAGTCCTCGCTGGCTACTCCGTCCGAGTTCTCCGAGCACCTGCAACGCTATGCTGGACGAAGGGAT
CGTAGTCTGGTTGCCACGACCGCCGACGCCGTCCCGGATATACTTCCCGTGCGCCAAAACACGGATCCACTGCTT
TCCGTCTTCACGCCGATCCGCTCCGCGAAGCTCGTCTCCGTCACTGCTCCGTCCTCCATCCTGCTTCCTGCAGTC
TCTCACCTGTATCGGCTGGCGAACTATCCCATCGTACTACACATCTCGCTATTGCCCCGAAACCGCTCCGACTAC
TCGGCAATAACGTCGATTCGCAATTCGGGATGGGCGTTTTTACAGTCGGAAACGCTGCAGGAGGCGCAGGATATG
GCCATTACGGCTCATGCGCTGGCAATTCGAACGGGCAAAGGCGTCATTCACTTCTTCTCTCCCGCGTCTTCGGCC
GACGACGAACCAGTTGGCGCCGAGGACGCTGCTGTCGTTCGCGAGATCCTTGATATGGAGAGCGTGAGGAGGTTC
CAGTCGGGAGGCATTCAGGCTTCGGGCATTTATACCCATGATGGACACACGGCCATCTCCTCGGACCATCCGGAG
ACCACTTTGGCCAGCACCGGCTCGACAAAGAATGGAAACCTTCAGGCTTTTGCTCTGGGTGAGCGTCCCAAGGGA
ACATCGGTGGCGACGTCGGTCAAGTCGAGTGAGCACAGCGAGTCGTCTACGCCCGTGGCCCCTTCGTCGGTTGCC
ACGACAGTCGAGGCCACGCCGTCTCAGATATTGTCCGAAGATATCTACACATGTGTCAAGCGTATATGGTCACAG
ATCCAGCTCGCTCTGGGAAGGCAATACAATGCCTTCGAGTATTACGGCCCTACCGATGCCGAAAACTGTCTATTC
ATATTCGGATCCAACACCCGCTTGTTTCGAGATACAGTCAGCAATGCGAAGCCAGATGATGTCTTTGCCAAGGCT
GGCATCGTCGTTCCTCGTCTCTATCGACCCTGGATCGGCTCCAAGCTTAGTGGCGCCCTTCCCAGATCAGTCAAG
AGAGTCGCCGTCTTGGAACAGATGCACCGGGCCACCACGAAATGGGGTCCCCTCCTTATCGACATCCTCTCGTCG
GTTCATCGTGGACCAGGCGGTGTTCAGACCATTGTTGGATATCAGCTCGGATGTCTGGCTCCGGGGACCATTGTC
CAAGCGCTTCGTGGCGTTGTCCAAAACCTGTTGACTGAAAAGCCGGTCCAGAACCTGGAAGTCGGCGTTAAAGAT
GCGCCGCAGTTGCCATCCGACCCCAAGCCTCCTCAGTTGGAGACTGCGTACTCCAAGATACTGGACCAGCTCTTC
GGGCCAAGAGCCTACATTGCCAACGCTATCGACGCGGCGAATCCTGGGGTTTCTCCGGAGGTGTGGACGAGCCCA
GAGTTTGGCTTCGGCTCCTTGCTCGCACGTAAGGATGCCCGGGCCAAGTTCGTGGCCGAAGTCAAGGACGTCTCT
CGCAGCGGCTCTTTTGCCTCGGAAGAGCCGAAGAACCTGCTGGCTCGATGGGCATTGAGTGCCGGCTCGGAAAAT
CCACCAACTGACCTGGCCGATCAGGTCATTACCTGCCTGGAGTCTGATGGGTCATCGGCGGCTCAGTCGTTGCTA
TCGCGTCGCAGACATTTCTATCAGGAATCTTTATGGCTAATGGGCTCTGACGCCTGGGCATATGATCTCGGGAAC
TCGGGCGTTCATCACGTTTTGGCGTCGGGCGAAAACATCAACATGCTTATAATAGATTCGACTCCTTATTCAAGC
AGAGGAGCTGCCGATGCCGACCGGAGGAAGAAGGATATTGGACTCTACGCTATGAACTTTGGAAATGCCTACGTC
GCCTCCACCGCGGTCTACAGCTCTTACACGCAAGTCCTTCAAGCGATGCTGGAGGCAGCCAAATTCCAAGGGCCA
TCGGTCGTCTTGGCCTATCTGCCATATTTTGGCGAGACGGACTCACCCTTGACCGTTCTGCAAGAGACGAAAAGG
GCGGTTGAGGCCGGTTACTGGCCTCTATACAGGTGGAACCCCAATAACGAACAAGACAGCGAGCCGAGCTTCTCA
CTCGATTCGGAGCTCATCAAACAAGAGCTGAAGACGTTCCTGGCGAGGGATAACCAGCTGACACAGTTGATGAGA
AAAGAGCCCAAATTTGCGGCCAGCCTGGCGCAAGACTTTGGAACGGAGGTGAGAGCAAGGCAGAAGCGGAAAGCC
AGGGACGCGTACAACCAGCTCCTCGAGGGTCTGCTGGGGGCTCCCTTGACGATTCTCTTCGCATCGGACAATGGC
AATGGCGCCTCGTTGGCGAAGCGACTCGGCAACAGGGGCAGGGCGCGAGGGCTGAAGACGGTGGTCATGGCCATG
GAGGACTACCTGGTCGAGGACTTGGGAAGAGAAGAGAATGTGGTGTTCATCACGTCGACTGCTGGCCAGGGAGAG
TTTCCGCAGAACGGGCTGCCGTTCTGGGAAGCCATCAGGGGCAAGACGGATTTGGATCTGGCAACCGTCAACTTC
TCCGTCTTTGCTCTGGGCGACAGCCACTACTGGCCACGGAAGGAGGATAAGATATTCTACAACAAACCGGGCAAA
GACCTCGACAGGCTACTCTCGAATCTCGGCGGGGTTCGCCTCTGTGATATCGGGTTAGGCGATGATCAAGACCCG
GACGGGTATCAGACCGGTTACCAAGAATGGGAGCCGAAACTGTGGCAGGCACTGGGCGTTGACAAGGTTGACGGA
CTGCCGGAGGAGCCCCCGCCGATAACCAACGAAGACATCAAGCTGGCGTCCAACTACCTTCGGGGAACCATAGTC
GAAGGACTGGAAGATAGCAGCACAGGGGCCATCTCGGCGGCGGACCAACAGCTGACCAAGTTTCACGGAACTTAT
ATGCAGGATGACCGCGACGTGCGAGACGAGAGAAAGGCTCAGGGGCTGGAACCGGCCTACTCGTTCATGATCCGC
TGTAGGCTTCCGGGAGGCGTGGCGACGCCGCAGCAATGGCTTCAGATGGACGACATCAGCACCTCGCTGGGCAAC
GAGACGATGAAGCTCACAACGCGGCAGACGTTTCAGTTCCACGGCGTTGTGAAAGGGCGGCTGAAGCCAGCCATG
CAGGCCATCAACAGGGCTCTGATGACGACGATAGCAGCTTGCGGTGACGTGAACCGCAACGTCATGTGCAGTTCG
CTTCCGACGCAGTCTCACTATCACAAGCAGGTCCACGCCTGTTCGCAGAAGATCAGCCATCATCTGCTGCCCTCG
ACGTCAGCATATCACGAGATCTGGCTCACCAACGCCGACGACGGCAAGAAGATACAGGTGGCGGGCGATGCTCTT
CAGGACTTCGAACCGCTGTACGGCCCGACTTACCTCCCTCGCAAGTTCAAGATCACCATCGCGGTCCCACCTCAC
AACGACACGGACGTGTACGCGCACGATATCGGGCTGATTGCCATTGCCGGTTCCGACGGGCAGCTGGAGGGCTTC
AACGTCCTCGCGGGAGGAGGCATGGGGGCGACGCACAACAACAAGAAGACGTATCCGCAGACGGGCCGGATGATG
GGCTTCTGTGCCACAGACGAGATTCACGTGGCCTGTGAGAAGATCATGCTGGTGCAGCGAGACCACGGAGACCGA
AAGAACCGCAAGCACGCGAGGCTCAAGTACACCATCGACGACATGGGCCTCGACGTCTTCCGCGCCAAAGTCGAG
GCTCTCTGGGGTCGTCAGTTTGAGCCGGAGCGGCCGTTCCGCTTCACCAGCAACGTCGATACCTTTGGCTGGCAG
CGTGACGAGACGGGCCTCAACCACTTTGGCCTCTTCATCGAGAATGGTCGGATCGAGGACCGGCCCGAGTTTCGG
ATGAAGACGGGTCTCCGTGAGGTGGCCAAGCTGCACAAGGGCGAGTTTCGCCTCACGGGCAACCAGCACCTGATC
CTCAGCAACGTGGCCGACGATGACTTGCCCGCCATGAAGCGTCTGCTGGCTGAGTACGGCCTCGACAACGTGCAG
TTTTCGGGTCTGCGTCTCAGCTCTTCCGCCTGCGTGGCGTTTCCCACCTGTGGACTGGCCATGGCCGAGTCGGAG
CGTTACCTGCCAGAGCTCATCAGCAAGCTAGAGTCGTGTCTCGAGGACAACGGGCTGCGGCAGGAGTCCATCGTG
ATGCGCATGACGGGCTGTCCCAACGGCTGTGCCAGGCCGTGGCTCGCCGAGGTGGCCTTTGTCGGCAAGGCATAC
GGAGCCTATAACATGTATCTGGGAGGAGGTTACCACGGCCAACGTCTCAACAAGCTGTACCGATCCAGCATCAAG
GAGGATGAGATTCTGGCGATTATGAAACCGCTGCTCAAGCGGTATGCGCTAGAGAGGTTGCCGGATGAGCGGTTC
GGCGATTTCTGCATCCGCGTTGGACTCGTTCACGCTACGAGGGACGGGCGAGACTTTCACGATGATGTTGCTGAG
GAGGAGTCGGGCGAAGAATAG
Transcript >Ophcf2|05606
ATGGAAGCATCTCCGTCGATCCGCAAGCCGGAAGAGGCCGTGGCCCGGATCGCCTACCTTGCCAGCGATGTCGTC
GTTGCGGTACAGTCCTCGCTGGCTACTCCGTCCGAGTTCTCCGAGCACCTGCAACGCTATGCTGGACGAAGGGAT
CGTAGTCTGGTTGCCACGACCGCCGACGCCGTCCCGGATATACTTCCCGTGCGCCAAAACACGGATCCACTGCTT
TCCGTCTTCACGCCGATCCGCTCCGCGAAGCTCGTCTCCGTCACTGCTCCGTCCTCCATCCTGCTTCCTGCAGTC
TCTCACCTGTATCGGCTGGCGAACTATCCCATCGTACTACACATCTCGCTATTGCCCCGAAACCGCTCCGACTAC
TCGGCAATAACGTCGATTCGCAATTCGGGATGGGCGTTTTTACAGTCGGAAACGCTGCAGGAGGCGCAGGATATG
GCCATTACGGCTCATGCGCTGGCAATTCGAACGGGCAAAGGCGTCATTCACTTCTTCTCTCCCGCGTCTTCGGCC
GACGACGAACCAGTTGGCGCCGAGGACGCTGCTGTCGTTCGCGAGATCCTTGATATGGAGAGCGTGAGGAGGTTC
CAGTCGGGAGGCATTCAGGCTTCGGGCATTTATACCCATGATGGACACACGGCCATCTCCTCGGACCATCCGGAG
ACCACTTTGGCCAGCACCGGCTCGACAAAGAATGGAAACCTTCAGGCTTTTGCTCTGGGTGAGCGTCCCAAGGGA
ACATCGGTGGCGACGTCGGTCAAGTCGAGTGAGCACAGCGAGTCGTCTACGCCCGTGGCCCCTTCGTCGGTTGCC
ACGACAGTCGAGGCCACGCCGTCTCAGATATTGTCCGAAGATATCTACACATGTGTCAAGCGTATATGGTCACAG
ATCCAGCTCGCTCTGGGAAGGCAATACAATGCCTTCGAGTATTACGGCCCTACCGATGCCGAAAACTGTCTATTC
ATATTCGGATCCAACACCCGCTTGTTTCGAGATACAGTCAGCAATGCGAAGCCAGATGATGTCTTTGCCAAGGCT
GGCATCGTCGTTCCTCGTCTCTATCGACCCTGGATCGGCTCCAAGCTTAGTGGCGCCCTTCCCAGATCAGTCAAG
AGAGTCGCCGTCTTGGAACAGATGCACCGGGCCACCACGAAATGGGGTCCCCTCCTTATCGACATCCTCTCGTCG
GTTCATCGTGGACCAGGCGGTGTTCAGACCATTGTTGGATATCAGCTCGGATGTCTGGCTCCGGGGACCATTGTC
CAAGCGCTTCGTGGCGTTGTCCAAAACCTGTTGACTGAAAAGCCGGTCCAGAACCTGGAAGTCGGCGTTAAAGAT
GCGCCGCAGTTGCCATCCGACCCCAAGCCTCCTCAGTTGGAGACTGCGTACTCCAAGATACTGGACCAGCTCTTC
GGGCCAAGAGCCTACATTGCCAACGCTATCGACGCGGCGAATCCTGGGGTTTCTCCGGAGGTGTGGACGAGCCCA
GAGTTTGGCTTCGGCTCCTTGCTCGCACGTAAGGATGCCCGGGCCAAGTTCGTGGCCGAAGTCAAGGACGTCTCT
CGCAGCGGCTCTTTTGCCTCGGAAGAGCCGAAGAACCTGCTGGCTCGATGGGCATTGAGTGCCGGCTCGGAAAAT
CCACCAACTGACCTGGCCGATCAGGTCATTACCTGCCTGGAGTCTGATGGGTCATCGGCGGCTCAGTCGTTGCTA
TCGCGTCGCAGACATTTCTATCAGGAATCTTTATGGCTAATGGGCTCTGACGCCTGGGCATATGATCTCGGGAAC
TCGGGCGTTCATCACGTTTTGGCGTCGGGCGAAAACATCAACATGCTTATAATAGATTCGACTCCTTATTCAAGC
AGAGGAGCTGCCGATGCCGACCGGAGGAAGAAGGATATTGGACTCTACGCTATGAACTTTGGAAATGCCTACGTC
GCCTCCACCGCGGTCTACAGCTCTTACACGCAAGTCCTTCAAGCGATGCTGGAGGCAGCCAAATTCCAAGGGCCA
TCGGTCGTCTTGGCCTATCTGCCATATTTTGGCGAGACGGACTCACCCTTGACCGTTCTGCAAGAGACGAAAAGG
GCGGTTGAGGCCGGTTACTGGCCTCTATACAGGTGGAACCCCAATAACGAACAAGACAGCGAGCCGAGCTTCTCA
CTCGATTCGGAGCTCATCAAACAAGAGCTGAAGACGTTCCTGGCGAGGGATAACCAGCTGACACAGTTGATGAGA
AAAGAGCCCAAATTTGCGGCCAGCCTGGCGCAAGACTTTGGAACGGAGGTGAGAGCAAGGCAGAAGCGGAAAGCC
AGGGACGCGTACAACCAGCTCCTCGAGGGTCTGCTGGGGGCTCCCTTGACGATTCTCTTCGCATCGGACAATGGC
AATGGCGCCTCGTTGGCGAAGCGACTCGGCAACAGGGGCAGGGCGCGAGGGCTGAAGACGGTGGTCATGGCCATG
GAGGACTACCTGGTCGAGGACTTGGGAAGAGAAGAGAATGTGGTGTTCATCACGTCGACTGCTGGCCAGGGAGAG
TTTCCGCAGAACGGGCTGCCGTTCTGGGAAGCCATCAGGGGCAAGACGGATTTGGATCTGGCAACCGTCAACTTC
TCCGTCTTTGCTCTGGGCGACAGCCACTACTGGCCACGGAAGGAGGATAAGATATTCTACAACAAACCGGGCAAA
GACCTCGACAGGCTACTCTCGAATCTCGGCGGGGTTCGCCTCTGTGATATCGGGTTAGGCGATGATCAAGACCCG
GACGGGTATCAGACCGGTTACCAAGAATGGGAGCCGAAACTGTGGCAGGCACTGGGCGTTGACAAGGTTGACGGA
CTGCCGGAGGAGCCCCCGCCGATAACCAACGAAGACATCAAGCTGGCGTCCAACTACCTTCGGGGAACCATAGTC
GAAGGACTGGAAGATAGCAGCACAGGGGCCATCTCGGCGGCGGACCAACAGCTGACCAAGTTTCACGGAACTTAT
ATGCAGGATGACCGCGACGTGCGAGACGAGAGAAAGGCTCAGGGGCTGGAACCGGCCTACTCGTTCATGATCCGC
TGTAGGCTTCCGGGAGGCGTGGCGACGCCGCAGCAATGGCTTCAGATGGACGACATCAGCACCTCGCTGGGCAAC
GAGACGATGAAGCTCACAACGCGGCAGACGTTTCAGTTCCACGGCGTTGTGAAAGGGCGGCTGAAGCCAGCCATG
CAGGCCATCAACAGGGCTCTGATGACGACGATAGCAGCTTGCGGTGACGTGAACCGCAACGTCATGTGCAGTTCG
CTTCCGACGCAGTCTCACTATCACAAGCAGGTCCACGCCTGTTCGCAGAAGATCAGCCATCATCTGCTGCCCTCG
ACGTCAGCATATCACGAGATCTGGCTCACCAACGCCGACGACGGCAAGAAGATACAGGTGGCGGGCGATGCTCTT
CAGGACTTCGAACCGCTGTACGGCCCGACTTACCTCCCTCGCAAGTTCAAGATCACCATCGCGGTCCCACCTCAC
AACGACACGGACGTGTACGCGCACGATATCGGGCTGATTGCCATTGCCGGTTCCGACGGGCAGCTGGAGGGCTTC
AACGTCCTCGCGGGAGGAGGCATGGGGGCGACGCACAACAACAAGAAGACGTATCCGCAGACGGGCCGGATGATG
GGCTTCTGTGCCACAGACGAGATTCACGTGGCCTGTGAGAAGATCATGCTGGTGCAGCGAGACCACGGAGACCGA
AAGAACCGCAAGCACGCGAGGCTCAAGTACACCATCGACGACATGGGCCTCGACGTCTTCCGCGCCAAAGTCGAG
GCTCTCTGGGGTCGTCAGTTTGAGCCGGAGCGGCCGTTCCGCTTCACCAGCAACGTCGATACCTTTGGCTGGCAG
CGTGACGAGACGGGCCTCAACCACTTTGGCCTCTTCATCGAGAATGGTCGGATCGAGGACCGGCCCGAGTTTCGG
ATGAAGACGGGTCTCCGTGAGGTGGCCAAGCTGCACAAGGGCGAGTTTCGCCTCACGGGCAACCAGCACCTGATC
CTCAGCAACGTGGCCGACGATGACTTGCCCGCCATGAAGCGTCTGCTGGCTGAGTACGGCCTCGACAACGTGCAG
TTTTCGGGTCTGCGTCTCAGCTCTTCCGCCTGCGTGGCGTTTCCCACCTGTGGACTGGCCATGGCCGAGTCGGAG
CGTTACCTGCCAGAGCTCATCAGCAAGCTAGAGTCGTGTCTCGAGGACAACGGGCTGCGGCAGGAGTCCATCGTG
ATGCGCATGACGGGCTGTCCCAACGGCTGTGCCAGGCCGTGGCTCGCCGAGGTGGCCTTTGTCGGCAAGGCATAC
GGAGCCTATAACATGTATCTGGGAGGAGGTTACCACGGCCAACGTCTCAACAAGCTGTACCGATCCAGCATCAAG
GAGGATGAGATTCTGGCGATTATGAAACCGCTGCTCAAGCGGTATGCGCTAGAGAGGTTGCCGGATGAGCGGTTC
GGCGATTTCTGCATCCGCGTTGGACTCGTTCACGCTACGAGGGACGGGCGAGACTTTCACGATGATGTTGCTGAG
GAGGAGTCGGGCGAAGAATAG
Gene >Ophcf2|05606
ATGGAAGCATCTCCGTCGATCCGCAAGCCGGAAGAGGCCGGTACGTCGCGCGCTGCTGCATCTGAAGCCGGACTC
GACCATGGCATCAACTGACGGTGATAGTGGCCCGGATCGCCTACCTTGCCAGCGATGTCGTCGTTGCGGTACAGT
CCTCGCTGGCTACTCCGTCCGAGTTCTCCGAGCACCTGCAACGCTATGCTGGACGAAGGGATCGTAGTCTGGTTG
CCACGACCGCCGACGCCGTCCCGGATGTAAGTCATCTTGGTCCGGAGCCGTCTCGCTTTACCCGTGCCTGACTGC
TCGTTCAGATACTTCCCGTGCGCCAAAACACGGATCCACTGCTTTCCGTCTTCACGCCGATCCGCTCCGCGAAGC
TCGTCTCCGTCACTGCTCCGTCCTCCATCCTGCTTCCTGCAGTCTCTCACCTGTATCGGCTGGCGAACTATCCCA
TCGTACTACACATCTCGCTATTGCCCCGAAACCGCTCCGACTACTCGGCAATAACGTCGATTCGCAATTCGGGAT
GGGCGTTTTTACAGTCGGAAACGCTGCAGGAGGCGCAGGATATGGCCATTACGGCTCATGCGCTGGCAATTCGAA
CGGGCAAAGGCGTCATTCACTTCTTCTCTCCCGCGTCTTCGGCCGACGACGAACCAGTTGGCGCCGAGGACGCTG
CTGTCGTTCGCGAGATCCTTGATATGGAGAGCGTGAGGAGGTTCCAGTCGGGAGGCATTCAGGCTTCGGGCATTT
ATACCCATGATGGACACACGGCCATCTCCTCGGACCATCCGGAGACCACTTTGGCCAGCACCGGCTCGACAAAGA
ATGGAAACCTTCAGGCTTTTGCTCTGGGTGAGCGTCCCAAGGGAACATCGGTGGCGACGTCGGTCAAGTCGAGTG
AGCACAGCGAGTCGTCTACGCCCGTGGCCCCTTCGTCGGTTGCCACGACAGTCGAGGCCACGCCGTCTCAGATAT
TGTCCGAAGATATCTACACATGTGTCAAGCGTATATGGTCACAGATCCAGCTCGCTCTGGGAAGGCAATACAATG
CCTTCGAGTATTACGGCCCTACCGATGCCGAAAACTGTCTATTCATATTCGGATCCAACACCCGCTTGTTTCGAG
ATACAGTCAGCAATGCGAAGCCAGATGATGTCTTTGCCAAGGCTGGCATCGTCGTTCCTCGTCTCTATCGACCCT
GGATCGGCTCCAAGCTTAGTGGCGCCCTTCCCAGATCAGTCAAGAGAGTCGCCGTCTTGGAACAGATGCACCGGG
CCACCACGAAATGGGGTCCCCTCCTTATCGACATCCTCTCGTCGGTTCATCGTGGACCAGGCGGTGTTCAGACCA
TTGTTGGATATCAGCTCGGATGTCTGGCTCCGGGGACCATTGTCCAAGCGCTTCGTGGCGTTGTCCAAAACCTGT
TGACTGAAAAGCCGGTCCAGAACCTGGAAGTCGGCGTTAAAGATGCGCCGCAGTTGCCATCCGACCCCAAGCCTC
CTCAGTTGGAGACTGCGTACTCCAAGATACTGGACCAGCTCTTCGGGCCAAGAGCCTACATTGCCAACGCTATCG
ACGCGGCGAATCCTGGGGTTTCTCCGGAGGTGTGGACGAGCCCAGAGTTTGGCTTCGGCTCCTTGCTCGCACGTA
AGGATGCCCGGGCCAAGTTCGTGGCCGAAGTCAAGGACGTCTCTCGCAGCGGCTCTTTTGCCTCGGAAGAGCCGA
AGAACCTGCTGGCTCGATGGGCATTGAGTGCCGGCTCGGAAAATCCACCAACTGACCTGGCCGATCAGGTCATTA
CCTGCCTGGAGTCTGATGGGTCATCGGCGGCTCAGTCGTTGCTATCGCGTCGCAGACATTTCTATCAGGAATCTT
TATGGCTAATGGGCTCTGACGCCTGGGCATATGATCTCGGGAACTCGGGCGTTCATCACGTTTTGGCGTCGGGCG
AAAACATCAACATGCTTATAATAGATTCGACTCCTTATTCAAGCAGAGGAGCTGCCGATGCCGACCGGAGGAAGA
AGGATATTGGACTCTACGCTATGAACTTTGGAAATGCCTACGTCGCCTCCACCGCGGTCTACAGCTCTTACACGC
AAGTCCTTCAAGCGATGCTGGAGGCAGCCAAATTCCAAGGGCCATCGGTCGTCTTGGCCTATCTGCCATATTTTG
GCGAGACGGACTCACCCTTGACCGTTCTGCAAGAGACGAAAAGGGCGGTTGAGGCCGGTTACTGGCCTCTATACA
GGTGGAACCCCAATAACGAACAAGACAGCGAGCCGAGCTTCTCACTCGATTCGGAGCTCATCAAACAAGAGCTGA
AGACGTTCCTGGCGAGGGATAACCAGCTGACACAGTTGATGAGAAAAGAGCCCAAATTTGCGGCCAGCCTGGCGC
AAGACTTTGGAACGGAGGTGAGAGCAAGGCAGAAGCGGAAAGCCAGGGACGCGTACAACCAGCTCCTCGAGGGTC
TGCTGGGGGCTCCCTTGACGATTCTCTTCGCATCGGACAATGGCAATGGCGCCTCGTTGGCGAAGCGACTCGGCA
ACAGGGGCAGGGCGCGAGGGCTGAAGACGGTGGTCATGGCCATGGAGGACTACCTGGTCGAGGACTTGGGAAGAG
AAGAGAATGTGGTGTTCATCACGTCGACTGCTGGCCAGGGAGAGTTTCCGCAGAACGGGCTGCCGTTCTGGGAAG
CCATCAGGGGCAAGACGGATTTGGATCTGGCAACCGTCAACTTCTCCGTCTTTGCTCTGGGCGACAGCCACTACT
GGCCACGGAAGGAGGATAAGATATTCTACAACAAACCGGGCAAAGACCTCGACAGGCTACTCTCGAATCTCGGCG
GGGTTCGCCTCTGTGATATCGGGTTAGGCGATGATCAAGACCCGGACGGGTATCAGACCGGTTACCAAGAATGGG
AGCCGAAACTGTGGCAGGCACTGGGCGTTGACAAGGTTGACGGACTGCCGGAGGAGCCCCCGCCGATAACCAACG
AAGACATCAAGCTGGCGTCCAACTACCTTCGGGGAACCATAGTCGAAGGACTGGAAGATAGCAGCACAGGGGCCA
TCTCGGCGGCGGACCAACAGCTGACCAAGTTTCACGGAACTTATATGCAGGATGACCGCGACGTGCGAGACGAGA
GAAAGGCTCAGGGGCTGGAACCGGCCTACTCGTTCATGATCCGCTGTAGGCTTCCGGGAGGCGTGGCGACGCCGC
AGCAATGGCTTCAGATGGACGACATCAGCACCTCGCTGGGCAACGAGACGATGAAGCTCACAACGCGGCAGACGT
TTCAGTTCCACGGCGTTGTGAAAGGGCGGCTGAAGCCAGCCATGCAGGCCATCAACAGGGCTCTGATGACGACGA
TAGCAGCTTGCGGTGACGTGAACCGCAACGTCATGTGCAGTTCGCTTCCGACGCAGTCTCACTATCACAAGCAGG
TCCACGCCTGTTCGCAGAAGATCAGCCATCATCTGCTGCCCTCGACGTCAGCATATCACGAGATCTGGCTCACCA
ACGCCGACGACGGCAAGAAGATACAGGTGGCGGGCGATGCTCTTCAGGACTTCGAACCGCTGTACGGCCCGACTT
ACCTCCCTCGCAAGTTCAAGATCACCATCGCGGTCCCACCTCACAACGACACGGACGTGTACGCGCACGATATCG
GGCTGATTGCCATTGCCGGTTCCGACGGGCAGCTGGAGGGCTTCAACGTCCTCGCGGGAGGAGGCATGGGGGCGA
CGCACAACAACAAGAAGACGTATCCGCAGACGGGCCGGATGATGGGCTTCTGTGCCACAGACGAGATTCACGTGG
CCTGTGAGAAGATCATGCTGGTGCAGCGAGACCACGGAGACCGAAAGAACCGCAAGCACGCGAGGCTCAAGTACA
CCATCGACGACATGGGCCTCGACGTCTTCCGCGCCAAAGTCGAGGCTCTCTGGGGTCGTCAGTTTGAGCCGGAGC
GGCCGTTCCGCTTCACCAGCAACGTCGATACCTTTGGCTGGCAGCGTGACGAGACGGGCCTCAACCACTTTGGCC
TCTTCATCGAGAATGGTCGGATCGAGGACCGGCCCGAGTTTCGGATGAAGACGGGTCTCCGTGAGGTGGCCAAGC
TGCACAAGGGCGAGTTTCGCCTCACGGGCAACCAGCACCTGATCCTCAGCAACGTGGCCGACGATGACTTGCCCG
CCATGAAGCGTCTGCTGGCTGAGTACGGCCTCGACAACGTGCAGTTTTCGGGTCTGCGTCTCAGCTCTTCCGCCT
GCGTGGCGTTTCCCACCTGTGGACTGGCCATGGCCGAGTCGGAGCGTTACCTGCCAGAGCTCATCAGCAAGCTAG
AGTCGTGTCTCGAGGACAACGGGCTGCGGCAGGAGTCCATCGTGATGCGCATGACGGGCTGTCCCAACGGCTGTG
CCAGGCCGTGGCTCGCCGAGGTGGCCTTTGTCGGCAAGGCATACGGAGCCTATAACATGTATCTGGGAGGAGGTT
ACCACGGCCAACGTCTCAACAAGCTGTACCGATCCAGCATCAAGGAGGATGAGATTCTGGCGATTATGAAACCGC
TGCTCAAGCGGTATGCGCTAGAGAGGTTGCCGGATGAGCGGTTCGGCGATTTCTGCATCCGCGTTGGACTCGTTC
ACGCTACGAGGGACGGGCGAGACTTTCACGATGATGTGAGTTGTTGTTGATGATGGCGGTTACGTTCGGGATGCG
ATGAGGATGCTGACGTCAATCAATAATTCAAGGTTGCTGAGGAGGAGTCGGGCGAAGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail